![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.40: OB-fold [50198] (17 superfamilies) barrel, closed or partly opened n=5, S=10 or S=8; greek-key |
![]() | Superfamily b.40.4: Nucleic acid-binding proteins [50249] (18 families) ![]() |
![]() | Family b.40.4.0: automated matches [191416] (1 protein) not a true family |
![]() | Protein automated matches [190576] (52 species) not a true protein |
![]() | Species Streptomyces coelicolor [TaxId:1902] [196757] (1 PDB entry) |
![]() | Domain d4damf_: 4dam F: [201654] Other proteins in same PDB: d4dama2, d4damc2, d4dame2, d4damg2, d4damk2 automated match to d4dama_ |
PDB Entry: 4dam (more details), 1.7 Å
SCOPe Domain Sequences for d4damf_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4damf_ b.40.4.0 (F:) automated matches {Streptomyces coelicolor [TaxId: 1902]} mneimicavgnvattpvfrdlangpsvrfrlavtarywdreknawtdghtnfftvwanrq latnasgslavgdpvvvqgrlkvrtdvregqsrtsadidavaighdlarg
Timeline for d4damf_: