SCOPe 2.08: Domain d4damc1: 4dam C:1-111

Lineage for d4damc1 (4dam C:1-111)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.40: OB-fold [50198] (17 superfamilies)
   barrel, closed or partly opened n=5, S=10 or S=8; greek-key

4. Superfamily b.40.4: Nucleic acid-binding proteins [50249] (18 families)

5. Family b.40.4.0: automated matches [191416] (1 protein)
   not a true family

6. Protein automated matches [190576] (52 species)
   not a true protein

7. Species Streptomyces coelicolor [TaxId:1902] [196757] (1 PDB entry)

8. Domain d4damc1: 4dam C:1-111 [196760]
   Other proteins in same PDB: d4dama2, d4damc2, d4dame2, d4damg2, d4damk2
   automated match to d3a5ua_

Details for d4damc1

PDB Entry: 4dam, 1.7 Å

PDB Description: Crystal structure of small single-stranded DNA-binding protein from Streptomyces coelicolor

PDB Compounds: (C:) Single-stranded DNA-binding protein 1

SCOPe Domain Sequences for d4damc1:

Sequence, based on SEQRES records:

>d4damc1 b.40.4.0 (C:1-111) automated matches {Streptomyces coelicolor [TaxId: 1902]}
mneimicavgnvattpvfrdlangpsvrfrlavtarywdreknawtdghtnfftvwanrq
latnasgslavgdpvvvqgrlkvrtdvregqsrtsadidavaighdlargt

Sequence, based on observed residues (ATOM records):

>d4damc1 b.40.4.0 (C:1-111) automated matches {Streptomyces coelicolor [TaxId: 1902]}
mneimicavgnvattpvfrdlangpsvrfrlavtarywdawtdghtnfftvwanrqlatn
asgslavgdpvvvqgrlkvrrtsadidavaighdlargt

Timeline for d4damc1:

• d4damc1 first appeared in SCOPe 2.02, called d4damc_
  
• d4damc1 appears in SCOPe 2.07