| Class b: All beta proteins [48724] (180 folds) |
| Fold b.40: OB-fold [50198] (17 superfamilies) barrel, closed or partly opened n=5, S=10 or S=8; greek-key |
Superfamily b.40.4: Nucleic acid-binding proteins [50249] (18 families) ![]() |
| Family b.40.4.0: automated matches [191416] (1 protein) not a true family |
| Protein automated matches [190576] (52 species) not a true protein |
| Species Streptomyces coelicolor [TaxId:1902] [196757] (1 PDB entry) |
| Domain d4dama1: 4dam A:1-112 [196758] Other proteins in same PDB: d4dama2, d4damc2, d4dame2, d4damg2, d4damk2 automated match to d3a5ua_ |
PDB Entry: 4dam (more details), 1.7 Å
SCOPe Domain Sequences for d4dama1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4dama1 b.40.4.0 (A:1-112) automated matches {Streptomyces coelicolor [TaxId: 1902]}
mneimicavgnvattpvfrdlangpsvrfrlavtarywdreknawtdghtnfftvwanrq
latnasgslavgdpvvvqgrlkvrtdvregqsrtsadidavaighdlargta
Timeline for d4dama1: