Lineage for d4damb_ (4dam B:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2787872Fold b.40: OB-fold [50198] (17 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 2789270Superfamily b.40.4: Nucleic acid-binding proteins [50249] (18 families) (S)
  5. 2790411Family b.40.4.0: automated matches [191416] (1 protein)
    not a true family
  6. 2790412Protein automated matches [190576] (52 species)
    not a true protein
  7. 2790682Species Streptomyces coelicolor [TaxId:1902] [196757] (1 PDB entry)
  8. 2790684Domain d4damb_: 4dam B: [196759]
    Other proteins in same PDB: d4dama2, d4damc2, d4dame2, d4damg2, d4damk2
    automated match to d3a5ua_

Details for d4damb_

PDB Entry: 4dam (more details), 1.7 Å

PDB Description: Crystal structure of small single-stranded DNA-binding protein from Streptomyces coelicolor
PDB Compounds: (B:) Single-stranded DNA-binding protein 1

SCOPe Domain Sequences for d4damb_:

Sequence, based on SEQRES records: (download)

>d4damb_ b.40.4.0 (B:) automated matches {Streptomyces coelicolor [TaxId: 1902]}
mneimicavgnvattpvfrdlangpsvrfrlavtarywdreknawtdghtnfftvwanrq
latnasgslavgdpvvvqgrlkvrtdvregqsrtsadidavaighdlarg

Sequence, based on observed residues (ATOM records): (download)

>d4damb_ b.40.4.0 (B:) automated matches {Streptomyces coelicolor [TaxId: 1902]}
mneimicavgnvattpvfrdlangpsvrfrlavtarywdknawtdghtnfftvwanrqla
tnasgslavgdpvvvqgrlkvrtdvregqsrtsadidavaighdlarg

SCOPe Domain Coordinates for d4damb_:

Click to download the PDB-style file with coordinates for d4damb_.
(The format of our PDB-style files is described here.)

Timeline for d4damb_: