SCOPe 2.08: Domain d3c15c1: 3c15 C:36-66,C:202-388

Lineage for d3c15c1 (3c15 C:36-66,C:202-388)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.8: G proteins [52592] (81 proteins)
   core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest

6. Protein Transducin (alpha subunit) [52623] (4 species)
   common fold is interrupted with an all-alpha domain

7. Species Cow (Bos taurus) [TaxId:9913] [52624] (18 PDB entries)
   Uniprot P04896 39-388

8. Domain d3c15c1: 3c15 C:36-66,C:202-388 [199148]
   Other proteins in same PDB: d3c15a_, d3c15b_, d3c15c2
   automated match to d1azsc2
   complexed with cl, fok, gsp, mg, pop
   has additional subdomain(s) that are not in the common domain

Details for d3c15c1

PDB Entry: 3c15, 2.78 Å

PDB Description: complex of gs-alpha with the catalytic domains of mammalian adenylyl cyclase: complex with pyrophosphate and mg

PDB Compounds: (C:) Guanine nucleotide-binding protein G(s) subunit alpha isoforms short

SCOPe Domain Sequences for d3c15c1:

Sequence; same for both SEQRES and ATOM records:

>d3c15c1 c.37.1.8 (C:36-66,C:202-388) Transducin (alpha subunit) {Cow (Bos taurus) [TaxId: 9913]}
vyrathrllllgagesgkstivkqmrilhvnXvltsgifetkfqvdkvnfhmfdvggqrd
errkwiqcfndvtaiifvvasssynmvirednqtnrlqealnlfksiwnnrwlrtisvil
flnkqdllaekvlagkskiedyfpefaryttpedatpepgedprvtrakyfirdeflris
tasgdgrhycyphftcavdtenirrvfndcrdiiqrmhl

Timeline for d3c15c1:

• d3c15c1 first appeared in SCOPe 2.03
  
• d3c15c1 appears in SCOPe 2.07