Lineage for d3c15b_ (3c15 B:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2949054Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2954779Superfamily d.58.29: Nucleotide cyclase [55073] (3 families) (S)
    common fold is elaborated with additional secondary structures
  5. 2954780Family d.58.29.1: Adenylyl and guanylyl cyclase catalytic domain [55074] (6 proteins)
    Pfam PF00211
    structurally similar to the "palm" domain of DNA/RNA polymerase superfamily
  6. 2954829Protein Type II adenylyl cyclase C2 domain [55075] (1 species)
  7. 2954830Species Norway rat (Rattus norvegicus) [TaxId:10116] [55076] (9 PDB entries)
    Uniprot P26769 879-1077
  8. 2954834Domain d3c15b_: 3c15 B: [172982]
    Other proteins in same PDB: d3c15a_, d3c15c1, d3c15c2
    automated match to d1ab8b_
    complexed with cl, fok, gsp, mg, pop

Details for d3c15b_

PDB Entry: 3c15 (more details), 2.78 Å

PDB Description: complex of gs-alpha with the catalytic domains of mammalian adenylyl cyclase: complex with pyrophosphate and mg
PDB Compounds: (B:) Adenylate cyclase type 2

SCOPe Domain Sequences for d3c15b_:

Sequence, based on SEQRES records: (download)

>d3c15b_ d.58.29.1 (B:) Type II adenylyl cyclase C2 domain {Norway rat (Rattus norvegicus) [TaxId: 10116]}
hqsydcvcvmfasipdfkefytesdvnkegleclrllneiiadfddllskpkfsgvekik
tigstymaatglsaipsqehaqeperqymhigtmvefayalvgkldainkhsfndfklrv
ginhgpviagvigaqkpqydiwgntvnvasrmdstgvldkiqvteetslilqtlgytctc
rgiinvkgkgdlktyfvnt

Sequence, based on observed residues (ATOM records): (download)

>d3c15b_ d.58.29.1 (B:) Type II adenylyl cyclase C2 domain {Norway rat (Rattus norvegicus) [TaxId: 10116]}
hqsydcvcvmfasipdfkefytesdvnkegleclrllneiiadfddllskpkfsgvekik
tigstymaatglsairqymhigtmvefayalvgkldainkhsfndfklrvginhgpviag
vigaqkpqydiwgntvnvasrmdstgvldkiqvteetslilqtlgytctcrgiinvkgkg
dlktyfvnt

SCOPe Domain Coordinates for d3c15b_:

Click to download the PDB-style file with coordinates for d3c15b_.
(The format of our PDB-style files is described here.)

Timeline for d3c15b_: