SCOPe 2.01: Domain d3c15b_: 3c15 B:

Lineage for d3c15b_ (3c15 B:)

1. Root: SCOPe 2.01

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.29: Nucleotide cyclase [55073] (3 families)
   common fold is elaborated with additional secondary structures

5. Family d.58.29.1: Adenylyl and guanylyl cyclase catalytic domain [55074] (6 proteins)
   Pfam PF00211
   structurally similar to the "palm" domain of DNA/RNA polymerase superfamily

6. Protein Type II adenylyl cyclase C2 domain [55075] (1 species)

7. Species Norway rat (Rattus norvegicus) [TaxId:10116] [55076] (8 PDB entries)
   Uniprot P26769 879-1077

8. Domain d3c15b_: 3c15 B: [172982]
   automated match to d1ab8b_
   complexed with cl, fok, gsp, mg, pop

Details for d3c15b_

PDB Entry: 3c15, 2.78 Å

PDB Description: complex of gs-alpha with the catalytic domains of mammalian adenylyl cyclase: complex with pyrophosphate and mg

PDB Compounds: (B:) Adenylate cyclase type 2

SCOPe Domain Sequences for d3c15b_:

Sequence, based on SEQRES records:

>d3c15b_ d.58.29.1 (B:) Type II adenylyl cyclase C2 domain {Norway rat (Rattus norvegicus) [TaxId: 10116]}
hqsydcvcvmfasipdfkefytesdvnkegleclrllneiiadfddllskpkfsgvekik
tigstymaatglsaipsqehaqeperqymhigtmvefayalvgkldainkhsfndfklrv
ginhgpviagvigaqkpqydiwgntvnvasrmdstgvldkiqvteetslilqtlgytctc
rgiinvkgkgdlktyfvnt

Sequence, based on observed residues (ATOM records):

>d3c15b_ d.58.29.1 (B:) Type II adenylyl cyclase C2 domain {Norway rat (Rattus norvegicus) [TaxId: 10116]}
hqsydcvcvmfasipdfkefytesdvnkegleclrllneiiadfddllskpkfsgvekik
tigstymaatglsairqymhigtmvefayalvgkldainkhsfndfklrvginhgpviag
vigaqkpqydiwgntvnvasrmdstgvldkiqvteetslilqtlgytctcrgiinvkgkg
dlktyfvnt

Timeline for d3c15b_:

• d3c15b_ is new in SCOPe 2.01-stable
  
• d3c15b_ appears in SCOPe 2.02
  
• d3c15b_ appears in the current release, SCOPe 2.08