| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.23: Open three-helical up-and-down bundle [47143] (7 superfamilies) core: 3 helices; bundle, open |
Superfamily a.23.2: Diol dehydratase, gamma subunit [47148] (1 family) ![]() contains irregular N-terminal subdomain automatically mapped to Pfam PF02287 |
| Family a.23.2.1: Diol dehydratase, gamma subunit [47149] (2 proteins) |
| Protein Diol dehydratase, gamma subunit [47150] (2 species) |
| Species Klebsiella oxytoca [TaxId:571] [47151] (8 PDB entries) |
| Domain d3aujm_: 3auj M: [198942] Other proteins in same PDB: d3auja_, d3aujb_, d3auje_, d3aujl_ automated match to d1egvg_ complexed with b12, ca, gol, po4 |
PDB Entry: 3auj (more details), 2.1 Å
SCOPe Domain Sequences for d3aujm_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3aujm_ a.23.2.1 (M:) Diol dehydratase, gamma subunit {Klebsiella oxytoca [TaxId: 571]}
rsarvsdyplankhpewvktatnktlddftlenvlsnkvtaqdmritpetlrlqasiakd
agrdrlamnferaaeltavpddrileiynalrpyrstkeellaiaddlesryqakicaaf
vreaatlyverkklkgdd
Timeline for d3aujm_: