Lineage for d3aujg_ (3auj G:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2311135Fold a.23: Open three-helical up-and-down bundle [47143] (7 superfamilies)
    core: 3 helices; bundle, open
  4. 2311143Superfamily a.23.2: Diol dehydratase, gamma subunit [47148] (1 family) (S)
    contains irregular N-terminal subdomain
    automatically mapped to Pfam PF02287
  5. 2311144Family a.23.2.1: Diol dehydratase, gamma subunit [47149] (2 proteins)
  6. 2311145Protein Diol dehydratase, gamma subunit [47150] (2 species)
  7. 2311146Species Klebsiella oxytoca [TaxId:571] [47151] (8 PDB entries)
  8. 2311157Domain d3aujg_: 3auj G: [198941]
    Other proteins in same PDB: d3auja_, d3aujb_, d3auje_, d3aujl_
    automated match to d1egvg_
    complexed with b12, ca, gol, po4

Details for d3aujg_

PDB Entry: 3auj (more details), 2.1 Å

PDB Description: Structure of diol dehydratase complexed with glycerol
PDB Compounds: (G:) diol dehydrase gamma subunit

SCOPe Domain Sequences for d3aujg_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3aujg_ a.23.2.1 (G:) Diol dehydratase, gamma subunit {Klebsiella oxytoca [TaxId: 571]}
srsarvsdyplankhpewvktatnktlddftlenvlsnkvtaqdmritpetlrlqasiak
dagrdrlamnferaaeltavpddrileiynalrpyrstkeellaiaddlesryqakicaa
fvreaatlyverkklkgdd

SCOPe Domain Coordinates for d3aujg_:

Click to download the PDB-style file with coordinates for d3aujg_.
(The format of our PDB-style files is described here.)

Timeline for d3aujg_: