SCOPe 2.03: Domain d3aujm_: 3auj M:

Lineage for d3aujm_ (3auj M:)

1. Root: SCOPe 2.03

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.23: Open three-helical up-and-down bundle [47143] (7 superfamilies)
   core: 3 helices; bundle, open

4. Superfamily a.23.2: Diol dehydratase, gamma subunit [47148] (1 family)
   contains irregular N-terminal subdomain
   automatically mapped to Pfam PF02287

5. Family a.23.2.1: Diol dehydratase, gamma subunit [47149] (1 protein)

6. Protein Diol dehydratase, gamma subunit [47150] (2 species)

7. Species Klebsiella oxytoca [TaxId:571] [47151] (8 PDB entries)

8. Domain d3aujm_: 3auj M: [198942]
   Other proteins in same PDB: d3auja_, d3aujb_, d3auje_, d3aujl_
   automated match to d1egvg_
   complexed with b12, ca, gol, po4

Details for d3aujm_

PDB Entry: 3auj, 2.1 Å

PDB Description: Structure of diol dehydratase complexed with glycerol

PDB Compounds: (M:) diol dehydrase gamma subunit

SCOPe Domain Sequences for d3aujm_:

Sequence; same for both SEQRES and ATOM records:

>d3aujm_ a.23.2.1 (M:) Diol dehydratase, gamma subunit {Klebsiella oxytoca [TaxId: 571]}
rsarvsdyplankhpewvktatnktlddftlenvlsnkvtaqdmritpetlrlqasiakd
agrdrlamnferaaeltavpddrileiynalrpyrstkeellaiaddlesryqakicaaf
vreaatlyverkklkgdd

Timeline for d3aujm_:

• d3aujm_ is new in SCOPe 2.03-stable
  
• d3aujm_ appears in SCOPe 2.04
  
• d3aujm_ appears in the current release, SCOPe 2.08