Lineage for d3auja_ (3auj A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2078560Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2089476Superfamily c.1.19: Cobalamin (vitamin B12)-dependent enzymes [51703] (4 families) (S)
  5. 2089521Family c.1.19.3: Diol dehydratase, alpha subunit [51710] (2 protein domains)
    automatically mapped to Pfam PF02286
  6. 2089543Protein automated matches [196011] (1 species)
    not a true protein
  7. 2089544Species Klebsiella oxytoca [TaxId:571] [196012] (1 PDB entry)
  8. 2089545Domain d3auja_: 3auj A: [196014]
    Other proteins in same PDB: d3aujb_, d3auje_, d3aujg_, d3aujm_
    automated match to d1iwpa_
    complexed with b12, ca, gol, po4

Details for d3auja_

PDB Entry: 3auj (more details), 2.1 Å

PDB Description: Structure of diol dehydratase complexed with glycerol
PDB Compounds: (A:) diol dehydrase alpha subunit

SCOPe Domain Sequences for d3auja_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3auja_ c.1.19.3 (A:) automated matches {Klebsiella oxytoca [TaxId: 571]}
mrskrfealakrpvnqdgfvkewieegfiamespndpkpsikivngavteldgkpvsdfd
lidhfiaryginlnraeevmamdsvklanmlcdpnvkrseivplttamtpakivevvshm
nvvemmmamqkmrarrtpsqqahvtnvkdnpvqiaadaaegawrgfdeqettvavaryap
fnaiallvgsqvgrpgvltqcsleeatelklgmlghtcyaetisvygtepvftdgddtpw
skgflassyasrglkmrftsgsgsevqmgyaegksmlylearciyitkaagvqglqngsv
scigvpsavpsgiravlaenlicssldlecassndqtfthsdmrrtarllmqflpgtdfi
ssgysavpnydnmfagsnedaedfddynviqrdlkvdgglrpvreedviairnkaaralq
avfagmglppitdeeveaatyahgskdmpernivedikfaqeiinknrnglevvkalaqg
gftdvaqdmlniqkakltgdylhtsaiivgdgqvlsavndvndyagpatgyrlqgerwee
iknipgaldpne

SCOPe Domain Coordinates for d3auja_:

Click to download the PDB-style file with coordinates for d3auja_.
(The format of our PDB-style files is described here.)

Timeline for d3auja_: