| Class a: All alpha proteins [46456] (286 folds) |
| Fold a.1: Globin-like [46457] (2 superfamilies) core: 6 helices; folded leaf, partly opened |
Superfamily a.1.2: alpha-helical ferredoxin [46548] (3 families) ![]() contains two Fe4-S4 clusters |
| Family a.1.2.1: Fumarate reductase/Succinate dehydogenase iron-sulfur protein, C-terminal domain [46549] (3 proteins) |
| Protein Succinate dehydogenase [81669] (3 species) |
| Species Escherichia coli [TaxId:562] [81670] (5 PDB entries) |
| Domain d2wu5f2: 2wu5 F:107-238 [198581] Other proteins in same PDB: d2wu5a1, d2wu5a2, d2wu5a3, d2wu5b1, d2wu5c_, d2wu5e1, d2wu5e2, d2wu5e3, d2wu5f1, d2wu5g_, d2wu5i1, d2wu5i2, d2wu5i3, d2wu5j1, d2wu5k_ automated match to d1nekb1 complexed with cbe, f3s, fad, fes, hem, na, sf4, teo; mutant |
PDB Entry: 2wu5 (more details), 2.8 Å
SCOPe Domain Sequences for d2wu5f2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2wu5f2 a.1.2.1 (F:107-238) Succinate dehydogenase {Escherichia coli [TaxId: 562]}
mgqfyaqyekikpyllnngqnpparehlqmpeqrekldglyecilcaccstscpsfwwnp
dkfigpagllaayrflidsrdtetdsrldglsdafsvfrchsimncvsvcpkglnptrai
ghiksmllqrna
Timeline for d2wu5f2: