Lineage for d2wu5f2 (2wu5 F:107-238)

  1. Root: SCOPe 2.03
  2. 1253684Class a: All alpha proteins [46456] (284 folds)
  3. 1253685Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 1256293Superfamily a.1.2: alpha-helical ferredoxin [46548] (3 families) (S)
    contains two Fe4-S4 clusters
  5. 1256294Family a.1.2.1: Fumarate reductase/Succinate dehydogenase iron-sulfur protein, C-terminal domain [46549] (3 proteins)
  6. 1256325Protein Succinate dehydogenase [81669] (1 species)
  7. 1256326Species Escherichia coli [TaxId:562] [81670] (6 PDB entries)
  8. 1256334Domain d2wu5f2: 2wu5 F:107-238 [198581]
    Other proteins in same PDB: d2wu5a1, d2wu5a2, d2wu5a3, d2wu5b1, d2wu5c_, d2wu5e1, d2wu5e2, d2wu5e3, d2wu5f1, d2wu5g_, d2wu5i1, d2wu5i2, d2wu5i3, d2wu5j1, d2wu5k_
    automated match to d1nekb1
    complexed with cbe, f3s, fad, fes, hem, na, sf4, teo; mutant

Details for d2wu5f2

PDB Entry: 2wu5 (more details), 2.8 Å

PDB Description: crystal structure of the e. coli succinate:quinone oxidoreductase (sqr) sdhd his71met mutant
PDB Compounds: (F:) succinate dehydrogenase iron-sulfur subunit

SCOPe Domain Sequences for d2wu5f2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2wu5f2 a.1.2.1 (F:107-238) Succinate dehydogenase {Escherichia coli [TaxId: 562]}
mgqfyaqyekikpyllnngqnpparehlqmpeqrekldglyecilcaccstscpsfwwnp
dkfigpagllaayrflidsrdtetdsrldglsdafsvfrchsimncvsvcpkglnptrai
ghiksmllqrna

SCOPe Domain Coordinates for d2wu5f2:

Click to download the PDB-style file with coordinates for d2wu5f2.
(The format of our PDB-style files is described here.)

Timeline for d2wu5f2: