SCOPe 2.05: Domain d1nekb1: 1nek B:107-238

Lineage for d1nekb1 (1nek B:107-238)

Root: SCOPe 2.05
Class a: All alpha proteins [46456] (286 folds)
Fold a.1: Globin-like [46457] (2 superfamilies)
core: 6 helices; folded leaf, partly opened
Superfamily a.1.2: alpha-helical ferredoxin [46548] (3 families)
contains two Fe4-S4 clusters
Family a.1.2.1: Fumarate reductase/Succinate dehydogenase iron-sulfur protein, C-terminal domain [46549] (3 proteins)
Protein Succinate dehydogenase [81669] (3 species)
Species Escherichia coli [TaxId:562] [81670] (5 PDB entries)
Domain d1nekb1: 1nek B:107-238 [80429]
Other proteins in same PDB: d1neka1, d1neka2, d1neka3, d1nekb2, d1nekc_, d1nekd_
complexed with ca, cdn, eph, f3s, fad, fes, hem, oaa, sf4, uq2

Details for d1nekb1

PDB Entry: 1nek (more details), 2.6 Å

PDB Description: Complex II (Succinate Dehydrogenase) From E. Coli with ubiquinone bound

PDB Compounds: (B:) Succinate dehydrogenase iron-sulfur protein

SCOPe Domain Sequences for d1nekb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1nekb1 a.1.2.1 (B:107-238) Succinate dehydogenase {Escherichia coli [TaxId: 562]}
mgqfyaqyekikpyllnngqnpparehlqmpeqrekldglyecilcaccstscpsfwwnp
dkfigpagllaayrflidsrdtetdsrldglsdafsvfrchsimncvsvcpkglnptrai
ghiksmllqrna

SCOPe Domain Coordinates for d1nekb1:

Click to download the PDB-style file with coordinates for d1nekb1.
(The format of our PDB-style files is described here.)

Timeline for d1nekb1: