SCOPe 2.08: Domain d1nekb1: 1nek B:107-238

Lineage for d1nekb1 (1nek B:107-238)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.1: Globin-like [46457] (2 superfamilies)
   core: 6 helices; folded leaf, partly opened

4. Superfamily a.1.2: alpha-helical ferredoxin [46548] (3 families)
   contains two Fe4-S4 clusters

5. Family a.1.2.1: Fumarate reductase/Succinate dehydogenase iron-sulfur protein, C-terminal domain [46549] (3 proteins)

6. Protein Succinate dehydogenase [81669] (3 species)

7. Species Escherichia coli [TaxId:562] [81670] (6 PDB entries)

8. Domain d1nekb1: 1nek B:107-238 [80429]
   Other proteins in same PDB: d1neka1, d1neka2, d1neka3, d1nekb2, d1nekc_, d1nekd_
   complexed with ca, cdn, eph, f3s, fad, fes, hem, oaa, sf4, uq2

Details for d1nekb1

PDB Entry: 1nek, 2.6 Å

PDB Description: Complex II (Succinate Dehydrogenase) From E. Coli with ubiquinone bound

PDB Compounds: (B:) Succinate dehydrogenase iron-sulfur protein

SCOPe Domain Sequences for d1nekb1:

Sequence; same for both SEQRES and ATOM records:

>d1nekb1 a.1.2.1 (B:107-238) Succinate dehydogenase {Escherichia coli [TaxId: 562]}
mgqfyaqyekikpyllnngqnpparehlqmpeqrekldglyecilcaccstscpsfwwnp
dkfigpagllaayrflidsrdtetdsrldglsdafsvfrchsimncvsvcpkglnptrai
ghiksmllqrna

Timeline for d1nekb1:

• d1nekb1 first appeared in SCOP 1.63
  
• d1nekb1 appears in SCOPe 2.07