Lineage for d1neka2 (1nek A:1-235,A:356-450)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2096453Fold c.3: FAD/NAD(P)-binding domain [51904] (1 superfamily)
    core: 3 layers, b/b/a; central parallel beta-sheet of 5 strands, order 32145; top antiparallel beta-sheet of 3 strands, meander
  4. 2096454Superfamily c.3.1: FAD/NAD(P)-binding domain [51905] (9 families) (S)
  5. 2096891Family c.3.1.4: Succinate dehydrogenase/fumarate reductase flavoprotein N-terminal domain [51934] (5 protein domains)
  6. 2096962Protein Succinate dehydogenase [82311] (2 species)
  7. 2096963Species Escherichia coli [TaxId:562] [82312] (6 PDB entries)
  8. 2096976Domain d1neka2: 1nek A:1-235,A:356-450 [80427]
    Other proteins in same PDB: d1neka1, d1neka3, d1nekb1, d1nekb2, d1nekc_, d1nekd_
    complexed with ca, cdn, eph, f3s, fad, fes, hem, oaa, sf4, uq2

Details for d1neka2

PDB Entry: 1nek (more details), 2.6 Å

PDB Description: Complex II (Succinate Dehydrogenase) From E. Coli with ubiquinone bound
PDB Compounds: (A:) Succinate dehydrogenase flavoprotein subunit

SCOPe Domain Sequences for d1neka2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1neka2 c.3.1.4 (A:1-235,A:356-450) Succinate dehydogenase {Escherichia coli [TaxId: 562]}
mklpvrefdavvigaggagmraalqisqsgqtcallskvfptrshtvsaqggitvalgnt
hednwewhmydtvkgsdyigdqdaieymcktgpeailelehmglpfsrlddgriyqrpfg
gqsknfggeqaartaaaadrtghallhtlyqqnlknhttifsewyaldlvknqdgavvgc
talcietgevvyfkaratvlatggagriyqsttnahintgdgvgmairagvpvqdXmmgg
iptkvtgqaltvnekgedvvvpglfavgeiacvsvhganrlggnslldlvvfgraaglhl
qesiaeqgalrdasesdveasldrlnrwnnn

SCOPe Domain Coordinates for d1neka2:

Click to download the PDB-style file with coordinates for d1neka2.
(The format of our PDB-style files is described here.)

Timeline for d1neka2: