SCOPe 2.05: Domain d2wu5b2: 2wu5 B:107-238

Lineage for d2wu5b2 (2wu5 B:107-238)

1. Root: SCOPe 2.05

2. Class a: All alpha proteins [46456] (286 folds)

3. Fold a.1: Globin-like [46457] (2 superfamilies)
   core: 6 helices; folded leaf, partly opened

4. Superfamily a.1.2: alpha-helical ferredoxin [46548] (3 families)
   contains two Fe4-S4 clusters

5. Family a.1.2.1: Fumarate reductase/Succinate dehydogenase iron-sulfur protein, C-terminal domain [46549] (3 proteins)

6. Protein Succinate dehydogenase [81669] (3 species)

7. Species Escherichia coli [TaxId:562] [81670] (5 PDB entries)

8. Domain d2wu5b2: 2wu5 B:107-238 [198576]
   Other proteins in same PDB: d2wu5a1, d2wu5a2, d2wu5a3, d2wu5b1, d2wu5c_, d2wu5e1, d2wu5e2, d2wu5e3, d2wu5f1, d2wu5g_, d2wu5i1, d2wu5i2, d2wu5i3, d2wu5j1, d2wu5k_
   automated match to d1nekb1
   complexed with cbe, f3s, fad, fes, hem, na, sf4, teo; mutant

Details for d2wu5b2

PDB Entry: 2wu5, 2.8 Å

PDB Description: crystal structure of the e. coli succinate:quinone oxidoreductase (sqr) sdhd his71met mutant

PDB Compounds: (B:) succinate dehydrogenase iron-sulfur subunit

SCOPe Domain Sequences for d2wu5b2:

Sequence; same for both SEQRES and ATOM records:

>d2wu5b2 a.1.2.1 (B:107-238) Succinate dehydogenase {Escherichia coli [TaxId: 562]}
mgqfyaqyekikpyllnngqnpparehlqmpeqrekldglyecilcaccstscpsfwwnp
dkfigpagllaayrflidsrdtetdsrldglsdafsvfrchsimncvsvcpkglnptrai
ghiksmllqrna

Timeline for d2wu5b2:

• d2wu5b2 first appeared in SCOPe 2.03
  
• d2wu5b2 appears in SCOPe 2.04
  
• d2wu5b2 appears in SCOPe 2.06
  
• d2wu5b2 appears in the current release, SCOPe 2.08