SCOPe 2.06: Domain d2r5ya1: 2r5y A:75-161

Lineage for d2r5ya1 (2r5y A:75-161)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.1: Homeodomain-like [46689] (20 families)
   consists only of helices

5. Family a.4.1.1: Homeodomain [46690] (41 proteins)
   Pfam PF00046

6. Protein automated matches [190360] (3 species)
   not a true protein

7. Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [187191] (6 PDB entries)

8. Domain d2r5ya1: 2r5y A:75-161 [198331]
   Other proteins in same PDB: d2r5ya2
   automated match to d1b8ia_
   protein/DNA complex

Details for d2r5ya1

PDB Entry: 2r5y, 2.6 Å

PDB Description: structure of scr/exd complex bound to a consensus hox-exd site

PDB Compounds: (A:) Homeotic protein Sex combs reduced

SCOPe Domain Sequences for d2r5ya1:

Sequence, based on SEQRES records:

>d2r5ya1 a.4.1.1 (A:75-161) automated matches {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
kknppqiypwmkrvhlgtstvnangetkrqrtsytryqtlelekefhfnryltrrrriei
ahalslterqikiwfqnrrmkwkkehk

Sequence, based on observed residues (ATOM records):

>d2r5ya1 a.4.1.1 (A:75-161) automated matches {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
kknppqiypwmkrvqrtsytryqtlelekefhfnryltrrrrieiahalslterqikiwf
qnrrmkwkkehk

Timeline for d2r5ya1:

• d2r5ya1 first appeared in SCOPe 2.03, called d2r5ya_
  
• d2r5ya1 was called d2r5ya_ in SCOPe 2.05
  
• d2r5ya1 appears in SCOPe 2.07
  
• d2r5ya1 appears in the current release, SCOPe 2.08