| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
Superfamily a.4.1: Homeodomain-like [46689] (21 families) ![]() consists only of helices |
| Family a.4.1.1: Homeodomain [46690] (41 proteins) Pfam PF00046 |
| Protein automated matches [190360] (3 species) not a true protein |
| Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [187191] (6 PDB entries) |
| Domain d2r5ya1: 2r5y A:75-161 [198331] Other proteins in same PDB: d2r5ya2 automated match to d1b8ia_ protein/DNA complex |
PDB Entry: 2r5y (more details), 2.6 Å
SCOPe Domain Sequences for d2r5ya1:
Sequence, based on SEQRES records: (download)
>d2r5ya1 a.4.1.1 (A:75-161) automated matches {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
kknppqiypwmkrvhlgtstvnangetkrqrtsytryqtlelekefhfnryltrrrriei
ahalslterqikiwfqnrrmkwkkehk
>d2r5ya1 a.4.1.1 (A:75-161) automated matches {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
kknppqiypwmkrvqrtsytryqtlelekefhfnryltrrrrieiahalslterqikiwf
qnrrmkwkkehk
Timeline for d2r5ya1: