Lineage for d2r5ya_ (2r5y A:)

  1. Root: SCOPe 2.03
  2. 1253684Class a: All alpha proteins [46456] (284 folds)
  3. 1257871Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 1257872Superfamily a.4.1: Homeodomain-like [46689] (20 families) (S)
    consists only of helices
  5. 1257873Family a.4.1.1: Homeodomain [46690] (41 proteins)
    Pfam PF00046
  6. 1258062Protein automated matches [190360] (2 species)
    not a true protein
  7. 1258063Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [187191] (5 PDB entries)
  8. 1258070Domain d2r5ya_: 2r5y A: [198331]
    automated match to d1b8ia_
    protein/DNA complex

Details for d2r5ya_

PDB Entry: 2r5y (more details), 2.6 Å

PDB Description: structure of scr/exd complex bound to a consensus hox-exd site
PDB Compounds: (A:) Homeotic protein Sex combs reduced

SCOPe Domain Sequences for d2r5ya_:

Sequence, based on SEQRES records: (download)

>d2r5ya_ a.4.1.1 (A:) automated matches {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
gkknppqiypwmkrvhlgtstvnangetkrqrtsytryqtlelekefhfnryltrrrrie
iahalslterqikiwfqnrrmkwkkehk

Sequence, based on observed residues (ATOM records): (download)

>d2r5ya_ a.4.1.1 (A:) automated matches {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
gkknppqiypwmkrvqrtsytryqtlelekefhfnryltrrrrieiahalslterqikiw
fqnrrmkwkkehk

SCOPe Domain Coordinates for d2r5ya_:

Click to download the PDB-style file with coordinates for d2r5ya_.
(The format of our PDB-style files is described here.)

Timeline for d2r5ya_:

View in 3D
Domains from other chains:
(mouse over for more information)
d2r5yb_