SCOPe 2.07: Domain d2fjfc2: 2fjf C:108-211

Lineage for d2fjfc2 (2fjf C:108-211)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein automated matches [190374] (17 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187221] (1235 PDB entries)

8. Domain d2fjfc2: 2fjf C:108-211 [197893]
   Other proteins in same PDB: d2fjfa1, d2fjfb1, d2fjfb2, d2fjfc1, d2fjfd1, d2fjfd2, d2fjfe1, d2fjff1, d2fjff2, d2fjfg1, d2fjfh1, d2fjfh2, d2fjfi1, d2fjfi2, d2fjfj1, d2fjfk1, d2fjfk2, d2fjfl1, d2fjfm1, d2fjfn1, d2fjfn2, d2fjfo1, d2fjfp1, d2fjfp2, d2fjfq1, d2fjfr1, d2fjfr2, d2fjfs1, d2fjft1, d2fjft2, d2fjfu1, d2fjfv1, d2fjfv2, d2fjfw1, d2fjfx1, d2fjfx2
   automated match to d1rhha2

Details for d2fjfc2

PDB Entry: 2fjf, 2.65 Å

PDB Description: Structure of the G6 Fab, a phage derived VEGF binding Fab

PDB Compounds: (C:) Light Chain of a VEGF binding Antibody

SCOPe Domain Sequences for d2fjfc2:

Sequence; same for both SEQRES and ATOM records:

>d2fjfc2 b.1.1.2 (C:108-211) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqd
skdstyslsstltlskadyekhkvyacevthqglsspvtksfnr

Timeline for d2fjfc2:

• d2fjfc2 first appeared in SCOPe 2.03
  
• d2fjfc2 appears in SCOPe 2.06
  
• d2fjfc2 appears in the current release, SCOPe 2.08