Lineage for d2fjfb1 (2fjf B:1-120)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2352459Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2352460Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2352461Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2352672Protein Immunoglobulin heavy chain variable domain, VH [88543] (22 species)
    VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogenous CDRs are listed as engineered species
  7. 2352676Species Engineered (including hybrid species) [88562] (71 PDB entries)
    SQ NA # humanized antidoby; bactericidal Fab-h6831 ! SQ NA # humanized antibody ! SQ NA # Humanized antibody ! SQ NA # engineered antibody
  8. 2352724Domain d2fjfb1: 2fjf B:1-120 [133579]
    Other proteins in same PDB: d2fjfa1, d2fjfa2, d2fjfb2, d2fjfc1, d2fjfc2, d2fjfd2, d2fjfe1, d2fjfe2, d2fjff2, d2fjfg1, d2fjfg2, d2fjfh2, d2fjfi2, d2fjfj1, d2fjfj2, d2fjfk2, d2fjfl1, d2fjfl2, d2fjfm1, d2fjfm2, d2fjfn2, d2fjfo1, d2fjfo2, d2fjfp2, d2fjfq1, d2fjfq2, d2fjfr2, d2fjfs1, d2fjfs2, d2fjft2, d2fjfu1, d2fjfu2, d2fjfv2, d2fjfw1, d2fjfw2, d2fjfx2
    automatically matched to d1fvcb_

Details for d2fjfb1

PDB Entry: 2fjf (more details), 2.65 Å

PDB Description: Structure of the G6 Fab, a phage derived VEGF binding Fab
PDB Compounds: (B:) Heavy Chain of a VEGF binding Antibody

SCOPe Domain Sequences for d2fjfb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2fjfb1 b.1.1.1 (B:1-120) Immunoglobulin heavy chain variable domain, VH {Engineered (including hybrid species)}
evqlvesggglvqpggslrlscaasgftisdywihwvrqapgkglewvagitpaggytyy
adsvkgrftisadtskntaylqmnslraedtavyycarfvfflpyamdywgqgtlvtvss

SCOPe Domain Coordinates for d2fjfb1:

Click to download the PDB-style file with coordinates for d2fjfb1.
(The format of our PDB-style files is described here.)

Timeline for d2fjfb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2fjfb2
View in 3D
Domains from other chains:
(mouse over for more information)
d2fjfa1, d2fjfa2, d2fjfc1, d2fjfc2, d2fjfd1, d2fjfd2, d2fjfe1, d2fjfe2, d2fjff1, d2fjff2, d2fjfg1, d2fjfg2, d2fjfh1, d2fjfh2, d2fjfi1, d2fjfi2, d2fjfj1, d2fjfj2, d2fjfk1, d2fjfk2, d2fjfl1, d2fjfl2, d2fjfm1, d2fjfm2, d2fjfn1, d2fjfn2, d2fjfo1, d2fjfo2, d2fjfp1, d2fjfp2, d2fjfq1, d2fjfq2, d2fjfr1, d2fjfr2, d2fjfs1, d2fjfs2, d2fjft1, d2fjft2, d2fjfu1, d2fjfu2, d2fjfv1, d2fjfv2, d2fjfw1, d2fjfw2, d2fjfx1, d2fjfx2