Lineage for d2fjfg1 (2fjf G:1-107)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2352459Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2352460Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2365354Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2365355Protein automated matches [190740] (29 species)
    not a true protein
  7. 2365565Species Human (Homo sapiens) [TaxId:9606] [187920] (1626 PDB entries)
  8. 2367338Domain d2fjfg1: 2fjf G:1-107 [197896]
    Other proteins in same PDB: d2fjfa2, d2fjfb1, d2fjfb2, d2fjfc2, d2fjfd1, d2fjfd2, d2fjfe2, d2fjff1, d2fjff2, d2fjfg2, d2fjfh1, d2fjfh2, d2fjfi1, d2fjfi2, d2fjfj2, d2fjfk1, d2fjfk2, d2fjfl2, d2fjfm2, d2fjfn1, d2fjfn2, d2fjfo2, d2fjfp1, d2fjfp2, d2fjfq2, d2fjfr1, d2fjfr2, d2fjfs2, d2fjft1, d2fjft2, d2fjfu2, d2fjfv1, d2fjfv2, d2fjfw2, d2fjfx1, d2fjfx2
    automated match to d1rhha1

Details for d2fjfg1

PDB Entry: 2fjf (more details), 2.65 Å

PDB Description: Structure of the G6 Fab, a phage derived VEGF binding Fab
PDB Compounds: (G:) Light Chain of a VEGF binding Antibody

SCOPe Domain Sequences for d2fjfg1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2fjfg1 b.1.1.0 (G:1-107) automated matches {Human (Homo sapiens) [TaxId: 9606]}
diqmtqspsslsasvgdrvtitcrasqdvstavawyqqkpgkapklliysasflysgvps
rfsgsgsgtdftltisslqpedfatyycqqsyttpptfgqgtkveik

SCOPe Domain Coordinates for d2fjfg1:

Click to download the PDB-style file with coordinates for d2fjfg1.
(The format of our PDB-style files is described here.)

Timeline for d2fjfg1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2fjfg2
View in 3D
Domains from other chains:
(mouse over for more information)
d2fjfa1, d2fjfa2, d2fjfb1, d2fjfb2, d2fjfc1, d2fjfc2, d2fjfd1, d2fjfd2, d2fjfe1, d2fjfe2, d2fjff1, d2fjff2, d2fjfh1, d2fjfh2, d2fjfi1, d2fjfi2, d2fjfj1, d2fjfj2, d2fjfk1, d2fjfk2, d2fjfl1, d2fjfl2, d2fjfm1, d2fjfm2, d2fjfn1, d2fjfn2, d2fjfo1, d2fjfo2, d2fjfp1, d2fjfp2, d2fjfq1, d2fjfq2, d2fjfr1, d2fjfr2, d2fjfs1, d2fjfs2, d2fjft1, d2fjft2, d2fjfu1, d2fjfu2, d2fjfv1, d2fjfv2, d2fjfw1, d2fjfw2, d2fjfx1, d2fjfx2