| Class a: All alpha proteins [46456] (285 folds) |
| Fold a.60: SAM domain-like [47768] (16 superfamilies) 4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins |
Superfamily a.60.14: eIF2alpha middle domain-like [116742] (2 families) ![]() |
| Family a.60.14.0: automated matches [227301] (1 protein) not a true family |
| Protein automated matches [227127] (1 species) not a true protein |
| Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [226786] (2 PDB entries) |
| Domain d2a19a2: 2a19 A:89-174 [197724] Other proteins in same PDB: d2a19a1, d2a19b_, d2a19c_ automated match to d1kl9a1 complexed with anp, mg, po4 |
PDB Entry: 2a19 (more details), 2.5 Å
SCOPe Domain Sequences for d2a19a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2a19a2 a.60.14.0 (A:89-174) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
vssediikceekyqksktvhsilrycaekfqipleelyktiawplsrkfghayeafklsi
idetvwegieppskdvldelknyisk
Timeline for d2a19a2: