SCOPe 2.05: Domain d2a19a2: 2a19 A:89-174

Lineage for d2a19a2 (2a19 A:89-174)

1. Root: SCOPe 2.05

2. Class a: All alpha proteins [46456] (286 folds)

3. Fold a.60: SAM domain-like [47768] (16 superfamilies)
   4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins

4. Superfamily a.60.14: eIF2alpha middle domain-like [116742] (2 families)

5. Family a.60.14.0: automated matches [227301] (1 protein)
   not a true family

6. Protein automated matches [227127] (1 species)
   not a true protein

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [226786] (2 PDB entries)

8. Domain d2a19a2: 2a19 A:89-174 [197724]
   Other proteins in same PDB: d2a19a1, d2a19b_, d2a19c_
   automated match to d1kl9a1
   complexed with anp, mg, po4

Details for d2a19a2

PDB Entry: 2a19, 2.5 Å

PDB Description: pkr kinase domain- eif2alpha- amp-pnp complex.

PDB Compounds: (A:) Eukaryotic translation initiation factor 2 alpha subunit

SCOPe Domain Sequences for d2a19a2:

Sequence; same for both SEQRES and ATOM records:

>d2a19a2 a.60.14.0 (A:89-174) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
vssediikceekyqksktvhsilrycaekfqipleelyktiawplsrkfghayeafklsi
idetvwegieppskdvldelknyisk

Timeline for d2a19a2:

• d2a19a2 first appeared in SCOPe 2.03
  
• d2a19a2 appears in SCOPe 2.04
  
• d2a19a2 appears in SCOPe 2.06
  
• d2a19a2 appears in the current release, SCOPe 2.08