PDB entry 2a19

View 2a19 on RCSB PDB site
Description: PKR kinase domain- eIF2alpha- AMP-PNP complex.
Class: protein synthesis/transferase
Keywords: transferase, kinase, protein biosynthesis, protein synthesis-transferase COMPLEX
Deposited on 2005-06-19, released 2005-09-27
The last revision prior to the SCOPe 2.04 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.234
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Eukaryotic translation initiation factor 2 alpha subunit
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: SUI2, TIF211
    Database cross-references and differences (RAF-indexed):
    • Uniprot P20459 (2-End)
      • cloning artifact (1)
    Domains in SCOPe 2.04: d2a19a1, d2a19a2
  • Chain 'B':
    Compound: Interferon-induced, double-stranded RNA-activated protein kinase
    Species: Homo sapiens [TaxId:9606]
    Gene: PRKR, EIF2AK2, PKR
    Database cross-references and differences (RAF-indexed):
    • Uniprot P19525 (3-270)
      • cloning artifact (1-2)
      • engineered (144)
      • modified residue (178)
    Domains in SCOPe 2.04: d2a19b_
  • Chain 'C':
    Compound: Interferon-induced, double-stranded RNA-activated protein kinase
    Species: Homo sapiens [TaxId:9606]
    Gene: PRKR, EIF2AK2, PKR
    Database cross-references and differences (RAF-indexed):
    • Uniprot P19525 (3-270)
      • cloning artifact (2)
      • engineered (144)
    Domains in SCOPe 2.04: d2a19c_
  • Heterogens: MG, PO4, ANP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2a19A (A:)
    gsshcrfyenkypeiddivmvnvqqiaemgayvklleydniegmillselsrrrirsiqk
    lirvgkndvavvlrvdkekgyidlskrrvssediikceekyqksktvhsilrycaekfqi
    pleelyktiawplsrkfghayeafklsiidetvwegieppskdvldelknyiskr
    

    Sequence, based on observed residues (ATOM records): (download)
    >2a19A (A:)
    sshcrfyenkypeiddivmvnvqqiaemgayvklleydniegmillssiqklirvgkndv
    avvlrvdkekgyidlskrrvssediikceekyqksktvhsilrycaekfqipleelykti
    awplsrkfghayeafklsiidetvwegieppskdvldelknyisk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2a19B (B:)
    gahtvdkrfgmdfkeieligsggfgqvfkakhridgktyvikrvkynnekaerevkalak
    ldhvnivhyngcwdgfdydpetssknssrsktkclfiqmefcdkgtleqwiekrrgekld
    kvlalelfeqitkgvdyihskklinrdlkpsniflvdtkqvkigdfglvtslkndgkrtr
    skgtlrymspeqissqdygkevdlyalglilaellhvcdtafetskfftdlrdgiisdif
    dkkektllqkllskkpedrpntseilrtltvwkkspeknerhta
    

    Sequence, based on observed residues (ATOM records): (download)
    >2a19B (B:)
    ahtvdkrfgmdfkeieligsggfgqvfkakhridgktyvikrvkynnekaerevkalakl
    dhvnivhyngcwdgfdydrsktkclfiqmefcdkgtleqwiekrrgekldkvlalelfeq
    itkgvdyihskklinrdlkpsniflvdtkqvkigdfglvtslkndgkrtrskgtlrymsp
    eqissqdygkevdlyalglilaellhvcdtafetskfftdlrdgiisdifdkkektllqk
    llskkpedrpntseilrtltvwkk
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2a19C (C:)
    gahtvdkrfgmdfkeieligsggfgqvfkakhridgktyvikrvkynnekaerevkalak
    ldhvnivhyngcwdgfdydpetssknssrsktkclfiqmefcdkgtleqwiekrrgekld
    kvlalelfeqitkgvdyihskklinrdlkpsniflvdtkqvkigdfglvtslkndgkrtr
    skgtlrymspeqissqdygkevdlyalglilaellhvcdtafetskfftdlrdgiisdif
    dkkektllqkllskkpedrpntseilrtltvwkkspeknerhta
    

    Sequence, based on observed residues (ATOM records): (download)
    >2a19C (C:)
    htvdkrfgmdfkeieligsggfgqvfkakhridgktyvikrvkynnekaerevkalakld
    hvnivhyngcwdgfdydpetsktkclfiqmefcdkgtllalelfeqitkgvdyihskkli
    nrdlkpsniflvdtkqvkigdfglvgkevdlyalglilaellgiisdifdkkektllqkl
    lskkpedrpntseilrtltvwkk