SCOPe 2.07: Domain d1xgta2: 1xgt A:108-214

Lineage for d1xgta2 (1xgt A:108-214)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein automated matches [190374] (17 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [224855] (654 PDB entries)

8. Domain d1xgta2: 1xgt A:108-214 [197639]
   Other proteins in same PDB: d1xgta1, d1xgtc_
   automated match to d1dqdl2
   mutant

Details for d1xgta2

PDB Entry: 1xgt, 2.1 Å

PDB Description: Structure for antibody HyHEL-63 Y33L mutant complexed with hen egg lysozyme

PDB Compounds: (A:) antibody kappa light chain

SCOPe Domain Sequences for d1xgta2:

Sequence; same for both SEQRES and ATOM records:

>d1xgta2 b.1.1.2 (A:108-214) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd
skdstysmsstltltkdeyerhnsytceathktstspivksfnrnec

Timeline for d1xgta2:

• d1xgta2 first appeared in SCOPe 2.03
  
• d1xgta2 appears in SCOPe 2.06
  
• d1xgta2 appears in the current release, SCOPe 2.08