| Class b: All beta proteins [48724] (174 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
| Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
| Protein automated matches [190374] (12 species) not a true protein |
| Species Escherichia coli [TaxId:562] [224854] (11 PDB entries) |
| Domain d1xgta2: 1xgt A:108-214 [197639] Other proteins in same PDB: d1xgta1, d1xgtc_ automated match to d1dqdl2 mutant |
PDB Entry: 1xgt (more details), 2.1 Å
SCOPe Domain Sequences for d1xgta2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1xgta2 b.1.1.2 (A:108-214) automated matches {Escherichia coli [TaxId: 562]}
radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd
skdstysmsstltltkdeyerhnsytceathktstspivksfnrnec
Timeline for d1xgta2: