| Class b: All beta proteins [48724] (178 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
| Family b.1.1.0: automated matches [191470] (1 protein) not a true family |
| Protein automated matches [190740] (29 species) not a true protein |
| Species Mouse (Mus musculus) [TaxId:10090] [188198] (822 PDB entries) |
| Domain d1xgta1: 1xgt A:0-107 [197638] Other proteins in same PDB: d1xgta2, d1xgtc_ automated match to d1dqdl1 mutant |
PDB Entry: 1xgt (more details), 2.1 Å
SCOPe Domain Sequences for d1xgta1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1xgta1 b.1.1.0 (A:0-107) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
mdivltqspatlsvtpgdsvslscrasqsisnnlhwyqqkshesprllikyasqsisgip
srfsgsgsgtdftlsinsvetedfgmyfcqqsnswpytfgggtkleik
Timeline for d1xgta1: