Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.110: Profilin-like [55769] (10 superfamilies) core: 2 alpha-helices and 5-stranded antiparallel sheet: order 21543; 3 layers: alpha/beta/alpha |
Superfamily d.110.3: PYP-like sensor domain (PAS domain) [55785] (8 families) alpha-beta(2)-alpha(2)-beta(3) |
Family d.110.3.0: automated matches [191387] (1 protein) not a true family |
Protein automated matches [190492] (4 species) not a true protein |
Species Mus musculus [TaxId:10090] [196720] (1 PDB entry) |
Domain d4hoia_: 4hoi A: [197389] automated match to d1bywa_ complexed with so4 |
PDB Entry: 4hoi (more details), 1.85 Å
SCOPe Domain Sequences for d4hoia_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4hoia_ d.110.3.0 (A:) automated matches {Mus musculus [TaxId: 10090]} shmtnfvlgnaqivdwpivysndgfcklsgyhraevmqkssacsfmygeltdkdtvekvr qtfenyemnsfeilmykknrtpvwffvkiapirneqdkvvlflctfsditafk
Timeline for d4hoia_: