Lineage for d1bywa_ (1byw A:)

  1. Root: SCOPe 2.02
  2. 1190016Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1215605Fold d.110: Profilin-like [55769] (10 superfamilies)
    core: 2 alpha-helices and 5-stranded antiparallel sheet: order 21543; 3 layers: alpha/beta/alpha
  4. 1215775Superfamily d.110.3: PYP-like sensor domain (PAS domain) [55785] (8 families) (S)
    alpha-beta(2)-alpha(2)-beta(3)
  5. 1215889Family d.110.3.6: Flavin-binding PAS domain [88853] (4 proteins)
    contains PAC motif
  6. 1215890Protein Erg potassium channel, N-terminal domain [55794] (1 species)
  7. 1215891Species Human (Homo sapiens) [TaxId:9606] [55795] (1 PDB entry)
  8. 1215892Domain d1bywa_: 1byw A: [40912]

Details for d1bywa_

PDB Entry: 1byw (more details), 2.6 Å

PDB Description: structure of the n-terminal domain of the human-erg potassium channel
PDB Compounds: (A:) protein (human erg potassium channel)

SCOPe Domain Sequences for d1bywa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bywa_ d.110.3.6 (A:) Erg potassium channel, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
srkfiianarvencaviycndgfcelcgysraevmqrpctcdflhgpctqrraaaqiaqa
llgaeerkveiafyrkdgscflclvdvvpvknedgavimfilnfevvmek

SCOPe Domain Coordinates for d1bywa_:

Click to download the PDB-style file with coordinates for d1bywa_.
(The format of our PDB-style files is described here.)

Timeline for d1bywa_: