PDB entry 4hoi
View 4hoi on RCSB PDB site
Description: Crystal structure of PAS domain from the mouse EAG1 potassium channel
Class: transport protein
Keywords: Potassium channel domain, TRANSPORT PROTEIN
Deposited on
2012-10-22, released
2013-03-27
The last revision prior to the SCOPe 2.02 freeze date was dated
2013-03-27, with a file datestamp of
2013-03-22.
Experiment type: XRAY
Resolution: 1.85 Å
R-factor: 0.168
AEROSPACI score: 0.53
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: Potassium voltage-gated channel subfamily H member 1
Species: Mus musculus [TaxId:10090]
Gene: Eag, Kcnh1
Database cross-references and differences (RAF-indexed):
- Chain 'B':
Compound: Potassium voltage-gated channel subfamily H member 1
Species: Mus musculus [TaxId:10090]
Gene: Eag, Kcnh1
Database cross-references and differences (RAF-indexed):
- Chain 'C':
Compound: Potassium voltage-gated channel subfamily H member 1
Species: Mus musculus [TaxId:10090]
Gene: Eag, Kcnh1
Database cross-references and differences (RAF-indexed):
- Chain 'D':
Compound: Potassium voltage-gated channel subfamily H member 1
Species: Mus musculus [TaxId:10090]
Gene: Eag, Kcnh1
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.02: d4hoid_ - Heterogens: SO4, HOH
PDB Chain Sequences:
- Chain 'A':
No sequence available.
- Chain 'B':
No sequence available.
- Chain 'C':
No sequence available.
- Chain 'D':
Sequence, based on SEQRES records: (download)
>4hoiD (D:)
gshmtnfvlgnaqivdwpivysndgfcklsgyhraevmqkssacsfmygeltdkdtvekv
rqtfenyemnsfeilmykknrtpvwffvkiapirneqdkvvlflctfsditafk
Sequence, based on observed residues (ATOM records): (download)
>4hoiD (D:)
tnfvlgnaqivdwpivysndgfcklsgyhraevmqkssacsfmygeltdkdtvekvrqtf
enyemnsfeilmykknrtpvwffvkiapirneqdkvvlflctfsditafk