SCOPe 2.08: Domain d4hoia1: 4hoi A:28-137

Lineage for d4hoia1 (4hoi A:28-137)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.110: Profilin-like [55769] (10 superfamilies)
   core: 2 alpha-helices and 5-stranded antiparallel sheet: order 21543; 3 layers: alpha/beta/alpha

4. Superfamily d.110.3: PYP-like sensor domain (PAS domain) [55785] (8 families)
   alpha-beta(2)-alpha(2)-beta(3)

5. Family d.110.3.0: automated matches [191387] (1 protein)
   not a true family

6. Protein automated matches [190492] (24 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [196720] (2 PDB entries)

8. Domain d4hoia1: 4hoi A:28-137 [197389]
   Other proteins in same PDB: d4hoia2, d4hoib2
   automated match to d1bywa_
   complexed with so4

Details for d4hoia1

PDB Entry: 4hoi, 1.85 Å

PDB Description: Crystal structure of PAS domain from the mouse EAG1 potassium channel

PDB Compounds: (A:) Potassium voltage-gated channel subfamily H member 1

SCOPe Domain Sequences for d4hoia1:

Sequence; same for both SEQRES and ATOM records:

>d4hoia1 d.110.3.0 (A:28-137) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
tnfvlgnaqivdwpivysndgfcklsgyhraevmqkssacsfmygeltdkdtvekvrqtf
enyemnsfeilmykknrtpvwffvkiapirneqdkvvlflctfsditafk

Timeline for d4hoia1:

• d4hoia1 first appeared in SCOPe 2.02, called d4hoia_
  
• d4hoia1 appears in SCOPe 2.07