![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily) barrel, closed; n=6, S=8; greek-key duplication: consists of two domains of the same fold |
![]() | Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) ![]() |
![]() | Family b.47.1.2: Eukaryotic proteases [50514] (49 proteins) |
![]() | Protein Chymase (mast cell protease I) [89343] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [89344] (13 PDB entries) |
![]() | Domain d4k60a_: 4k60 A: [197208] automated match to d3s0na_ complexed with 1p8, nag, zn |
PDB Entry: 4k60 (more details), 1.5 Å
SCOPe Domain Sequences for d4k60a_:
Sequence, based on SEQRES records: (download)
>d4k60a_ b.47.1.2 (A:) Chymase (mast cell protease I) {Human (Homo sapiens) [TaxId: 9606]} iiggteckphsrpymayleivtsngpskfcggflirrnfvltaahcagrsitvtlgahni teeedtwqklevikqfrhpkyntstlhhdimllklkekasltlavgtlpfpsqknfvppg rmcrvagwgrtgvlkpgsdtlqevklrlmdpqacshfrdfdhnlqlcvgnprktksafkg dsggpllcagaaqgivsygrsdakppavftrishyqpwinqilqan
>d4k60a_ b.47.1.2 (A:) Chymase (mast cell protease I) {Human (Homo sapiens) [TaxId: 9606]} iiggteckphsrpymayleivtngpskfcggflirrnfvltaahcagrsitvtlgahnit eeedtwqklevikqfrhpkyntstlhhdimllklkekasltlavgtlpfvppgrmcrvag wgrtgvlkpgsdtlqevklrlmdpqacshfrdfdhnlqlcvgnprktksafkgdsggpll cagaaqgivsygrsdakppavftrishyqpwinqilqan
Timeline for d4k60a_: