Lineage for d3s0na_ (3s0n A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2794584Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. 2794585Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) (S)
  5. 2794859Family b.47.1.2: Eukaryotic proteases [50514] (49 proteins)
  6. 2795068Protein Chymase (mast cell protease I) [89343] (1 species)
  7. 2795069Species Human (Homo sapiens) [TaxId:9606] [89344] (13 PDB entries)
  8. 2795078Domain d3s0na_: 3s0n A: [185242]
    automated match to d1pjpa_
    complexed with 0bb, nag, zn

Details for d3s0na_

PDB Entry: 3s0n (more details), 1.95 Å

PDB Description: crystal structure of human chymase with benzimidazolone inhibitor
PDB Compounds: (A:) Chymase

SCOPe Domain Sequences for d3s0na_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3s0na_ b.47.1.2 (A:) Chymase (mast cell protease I) {Human (Homo sapiens) [TaxId: 9606]}
iiggteckphsrpymayleivtsngpskfcggflirrnfvltaahcagrsitvtlgahni
teeedtwqklevikqfrhpkyntstlhhdimllklkekasltlavgtlpfpsqknfvppg
rmcrvagwgrtgvlkpgsdtlqevklrlmdpqacshfrdfdhnlqlcvgnprktksafkg
dsggpllcagaaqgivsygrsdakppavftrishyqpwinqilqan

SCOPe Domain Coordinates for d3s0na_:

Click to download the PDB-style file with coordinates for d3s0na_.
(The format of our PDB-style files is described here.)

Timeline for d3s0na_: