Lineage for d4k60a_ (4k60 A:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2404157Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. 2404158Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) (S)
  5. 2404432Family b.47.1.2: Eukaryotic proteases [50514] (49 proteins)
  6. 2404641Protein Chymase (mast cell protease I) [89343] (1 species)
  7. 2404642Species Human (Homo sapiens) [TaxId:9606] [89344] (13 PDB entries)
  8. 2404643Domain d4k60a_: 4k60 A: [197208]
    automated match to d3s0na_
    complexed with 1p8, nag, zn

Details for d4k60a_

PDB Entry: 4k60 (more details), 1.5 Å

PDB Description: crystal structure of human chymase in complex with fragment 6-bromo-1, 3-dihydro-2h-indol-2-one
PDB Compounds: (A:) Chymase

SCOPe Domain Sequences for d4k60a_:

Sequence, based on SEQRES records: (download)

>d4k60a_ b.47.1.2 (A:) Chymase (mast cell protease I) {Human (Homo sapiens) [TaxId: 9606]}
iiggteckphsrpymayleivtsngpskfcggflirrnfvltaahcagrsitvtlgahni
teeedtwqklevikqfrhpkyntstlhhdimllklkekasltlavgtlpfpsqknfvppg
rmcrvagwgrtgvlkpgsdtlqevklrlmdpqacshfrdfdhnlqlcvgnprktksafkg
dsggpllcagaaqgivsygrsdakppavftrishyqpwinqilqan

Sequence, based on observed residues (ATOM records): (download)

>d4k60a_ b.47.1.2 (A:) Chymase (mast cell protease I) {Human (Homo sapiens) [TaxId: 9606]}
iiggteckphsrpymayleivtngpskfcggflirrnfvltaahcagrsitvtlgahnit
eeedtwqklevikqfrhpkyntstlhhdimllklkekasltlavgtlpfvppgrmcrvag
wgrtgvlkpgsdtlqevklrlmdpqacshfrdfdhnlqlcvgnprktksafkgdsggpll
cagaaqgivsygrsdakppavftrishyqpwinqilqan

SCOPe Domain Coordinates for d4k60a_:

Click to download the PDB-style file with coordinates for d4k60a_.
(The format of our PDB-style files is described here.)

Timeline for d4k60a_: