SCOPe 2.06: Domain d4k60a_: 4k60 A:

Lineage for d4k60a_ (4k60 A:)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
   barrel, closed; n=6, S=8; greek-key
   duplication: consists of two domains of the same fold

4. Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families)

5. Family b.47.1.2: Eukaryotic proteases [50514] (49 proteins)

6. Protein Chymase (mast cell protease I) [89343] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [89344] (11 PDB entries)

8. Domain d4k60a_: 4k60 A: [197208]
   automated match to d3s0na_
   complexed with 1p8, nag, zn

Details for d4k60a_

PDB Entry: 4k60, 1.5 Å

PDB Description: crystal structure of human chymase in complex with fragment 6-bromo-1, 3-dihydro-2h-indol-2-one

PDB Compounds: (A:) Chymase

SCOPe Domain Sequences for d4k60a_:

Sequence, based on SEQRES records:

>d4k60a_ b.47.1.2 (A:) Chymase (mast cell protease I) {Human (Homo sapiens) [TaxId: 9606]}
iiggteckphsrpymayleivtsngpskfcggflirrnfvltaahcagrsitvtlgahni
teeedtwqklevikqfrhpkyntstlhhdimllklkekasltlavgtlpfpsqknfvppg
rmcrvagwgrtgvlkpgsdtlqevklrlmdpqacshfrdfdhnlqlcvgnprktksafkg
dsggpllcagaaqgivsygrsdakppavftrishyqpwinqilqan

Sequence, based on observed residues (ATOM records):

>d4k60a_ b.47.1.2 (A:) Chymase (mast cell protease I) {Human (Homo sapiens) [TaxId: 9606]}
iiggteckphsrpymayleivtngpskfcggflirrnfvltaahcagrsitvtlgahnit
eeedtwqklevikqfrhpkyntstlhhdimllklkekasltlavgtlpfvppgrmcrvag
wgrtgvlkpgsdtlqevklrlmdpqacshfrdfdhnlqlcvgnprktksafkgdsggpll
cagaaqgivsygrsdakppavftrishyqpwinqilqan

Timeline for d4k60a_:

• d4k60a_ first appeared in SCOPe 2.02
  
• d4k60a_ appears in SCOPe 2.05
  
• d4k60a_ appears in SCOPe 2.07
  
• d4k60a_ appears in the current release, SCOPe 2.08