Lineage for d1d4cc1 (1d4c C:3-102)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2734165Fold a.138: Multiheme cytochromes [48694] (1 superfamily)
    variable number of helices and little beta structure; not a true fold
    annotated by the SCOP(e) curators as 'not a true fold'
  4. 2734166Superfamily a.138.1: Multiheme cytochromes [48695] (4 families) (S)
    duplication: contains multiple CxxCH motifs
  5. 2734319Family a.138.1.3: Di-heme elbow motif [48711] (8 proteins)
    the main characteristic feature of this motif is the packing of its two hemes
    many members contains one or more complete motifs flanked by incomplete motifs and/or other domains
  6. 2734353Protein Flavocytochrome c3 (respiratory fumarate reductase), N-terminal domain [48721] (3 species)
  7. 2734388Species Shewanella putrefaciens [TaxId:24] [48723] (3 PDB entries)
  8. 2734392Domain d1d4cc1: 1d4c C:3-102 [19700]
    Other proteins in same PDB: d1d4ca2, d1d4ca3, d1d4cb2, d1d4cb3, d1d4cc2, d1d4cc3, d1d4cd2, d1d4cd3
    complexed with fad, hec, so4

Details for d1d4cc1

PDB Entry: 1d4c (more details), 2.9 Å

PDB Description: crystal structure of the uncomplexed form of the flavocytochrome c fumarate reductase of shewanella putrefaciens strain mr-1
PDB Compounds: (C:) flavocytochrome c fumarate reductase

SCOPe Domain Sequences for d1d4cc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1d4cc1 a.138.1.3 (C:3-102) Flavocytochrome c3 (respiratory fumarate reductase), N-terminal domain {Shewanella putrefaciens [TaxId: 24]}
evladfhgemggcdschvsdkggvtndnlthengqcvschgdlkelaaaapkdkvsphks
hligeiactschkgheksvaycdachsfgfdmpfggkwer

SCOPe Domain Coordinates for d1d4cc1:

Click to download the PDB-style file with coordinates for d1d4cc1.
(The format of our PDB-style files is described here.)

Timeline for d1d4cc1: