PDB entry 1d4c

View 1d4c on RCSB PDB site
Description: crystal structure of the uncomplexed form of the flavocytochrome c fumarate reductase of shewanella putrefaciens strain mr-1
Class: oxidoreductase
Keywords: tetraheme flavocytochrome c, oxidoreductase
Deposited on 1999-10-03, released 1999-12-01
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.9 Å
R-factor: 0.21
AEROSPACI score: 0.22 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: flavocytochrome c fumarate reductase
    Species: Shewanella oneidensis [TaxId:70863]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1d4ca1, d1d4ca2, d1d4ca3
  • Chain 'B':
    Compound: flavocytochrome c fumarate reductase
    Species: Shewanella oneidensis [TaxId:70863]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1d4cb1, d1d4cb2, d1d4cb3
  • Chain 'C':
    Compound: flavocytochrome c fumarate reductase
    Species: Shewanella oneidensis [TaxId:70863]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1d4cc1, d1d4cc2, d1d4cc3
  • Chain 'D':
    Compound: flavocytochrome c fumarate reductase
    Species: Shewanella oneidensis [TaxId:70863]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1d4cd1, d1d4cd2, d1d4cd3
  • Heterogens: SO4, HEM, FAD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1d4cA (A:)
    aapevladfhgemggcdschvsdkggvtndnlthengqcvschgdlkelaaaapkdkvsp
    hkshligeiactschkgheksvaycdachsfgfdmpfggkwerkfvpvdadkaaqdkaia
    agvkettdvviigsggaglaaavsardagakvillekepipggntklaaggmnaaetkpq
    aklgiedkkqimiddtmkggrnindpelvkvlannssdsidwltsmgadmtdvgrmggas
    vnrshrptggagvgahvaqvlwdnavkrgtdirlnsrvvriledasgkvtgvlvkgeytg
    yyvikadavviaaggfaknnervskydpklkgfkatnhpgatgdgldvalqagaatrdle
    yiqahptyspaggvmiteavrgngaivvnregnrfmneittrdkasaailqqkgesaylv
    fddsirkslkaiegyvhlnivkegktieelakqidvpaaelaktvtayngfvksgkdaqf
    erpdlprelvvapfyaleiapavhhtmgglvidtkaevksektgkpitglyaagevtggv
    hganrlggnaisdivtygriagasaakfakdn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1d4cA (A:)
    apevladfhgemggcdschvsdkggvtndnlthengqcvschgdlkelaaaapkdkvsph
    kshligeiactschkgheksvaycdachsfgfdmpfggkwerkfvpvdadkaaqdkaiaa
    gvkettdvviigsggaglaaavsardagakvillekepipggntklaaggmnaaetkpqa
    klgiedkkqimiddtmkggrnindpelvkvlannssdsidwltsmgadmtdvgrmggasv
    nrshrptggagvgahvaqvlwdnavkrgtdirlnsrvvriledasgkvtgvlvkgeytgy
    yvikadavviaaggfaknnervskydpklkgfkatnhpgatgdgldvalqagaatrdley
    iqahptyspaggvmiteavrgngaivvnregnrfmneittrdkasaailqqkgesaylvf
    ddsirkslkaiegyvhlnivkegktieelakqidvpaaelaktvtayngfvksgkdaqfe
    rpdlprelvvapfyaleiapavhhtmgglvidtkaevksektgkpitglyaagevtggvh
    ganrlggnaisdivtygriagasaakfakd
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1d4cB (B:)
    aapevladfhgemggcdschvsdkggvtndnlthengqcvschgdlkelaaaapkdkvsp
    hkshligeiactschkgheksvaycdachsfgfdmpfggkwerkfvpvdadkaaqdkaia
    agvkettdvviigsggaglaaavsardagakvillekepipggntklaaggmnaaetkpq
    aklgiedkkqimiddtmkggrnindpelvkvlannssdsidwltsmgadmtdvgrmggas
    vnrshrptggagvgahvaqvlwdnavkrgtdirlnsrvvriledasgkvtgvlvkgeytg
    yyvikadavviaaggfaknnervskydpklkgfkatnhpgatgdgldvalqagaatrdle
    yiqahptyspaggvmiteavrgngaivvnregnrfmneittrdkasaailqqkgesaylv
    fddsirkslkaiegyvhlnivkegktieelakqidvpaaelaktvtayngfvksgkdaqf
    erpdlprelvvapfyaleiapavhhtmgglvidtkaevksektgkpitglyaagevtggv
    hganrlggnaisdivtygriagasaakfakdn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1d4cB (B:)
    evladfhgemggcdschvsdkggvtndnlthengqcvschgdlkelaaaapkvsphkshl
    igeiactschkgheksvaycdachsfgfdmpfggkwerkfvpvdadkaaqdkaiaagvke
    ttdvviigsggaglaaavsardagakvillekepipggntklaaggmnaaetkpqaklgi
    edkkqimiddtmkggrnindpelvkvlannssdsidwltsmgadmtdvgrmggasvnrsh
    rptggagvgahvaqvlwdnavkrgtdirlnsrvvriledasgkvtgvlvkgeytgyyvik
    adavviaaggfaknnervskydpklkgfkatnhpgatgdgldvalqagaatrdleyiqah
    ptyspaggvmiteavrgngaivvnregnrfmneittrdkasaailqqkgesaylvfddsi
    rkslkaiegyvhlnivkegktieelakqidvpaaelaktvtayngfvksgkdaqferpdl
    prelvvapfyaleiapavhhtmgglvidtkaevksektgkpitglyaagevtggvhganr
    lggnaisdivtygriagasaakfakd
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1d4cC (C:)
    aapevladfhgemggcdschvsdkggvtndnlthengqcvschgdlkelaaaapkdkvsp
    hkshligeiactschkgheksvaycdachsfgfdmpfggkwerkfvpvdadkaaqdkaia
    agvkettdvviigsggaglaaavsardagakvillekepipggntklaaggmnaaetkpq
    aklgiedkkqimiddtmkggrnindpelvkvlannssdsidwltsmgadmtdvgrmggas
    vnrshrptggagvgahvaqvlwdnavkrgtdirlnsrvvriledasgkvtgvlvkgeytg
    yyvikadavviaaggfaknnervskydpklkgfkatnhpgatgdgldvalqagaatrdle
    yiqahptyspaggvmiteavrgngaivvnregnrfmneittrdkasaailqqkgesaylv
    fddsirkslkaiegyvhlnivkegktieelakqidvpaaelaktvtayngfvksgkdaqf
    erpdlprelvvapfyaleiapavhhtmgglvidtkaevksektgkpitglyaagevtggv
    hganrlggnaisdivtygriagasaakfakdn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1d4cC (C:)
    evladfhgemggcdschvsdkggvtndnlthengqcvschgdlkelaaaapkdkvsphks
    hligeiactschkgheksvaycdachsfgfdmpfggkwerkfvpvdadkaaqdkaiaagv
    kettdvviigsggaglaaavsardagakvillekepipggntklaaggmnaaetkpqakl
    giedkkqimiddtmkggrnindpelvkvlannssdsidwltsmgadmtdvgrmggasvnr
    shrptggagvgahvaqvlwdnavkrgtdirlnsrvvriledasgkvtgvlvkgeytgyyv
    ikadavviaaggfaknnervskydpklkgfkatnhpgatgdgldvalqagaatrdleyiq
    ahptyspaggvmiteavrgngaivvnregnrfmneittrdkasaailqqkgesaylvfdd
    sirkslkaiegyvhlnivkegktieelakqidvpaaelaktvtayngfvksgkdaqferp
    dlprelvvapfyaleiapavhhtmgglvidtkaevksektgkpitglyaagevtggvhga
    nrlggnaisdivtygriagasaakfakd
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1d4cD (D:)
    aapevladfhgemggcdschvsdkggvtndnlthengqcvschgdlkelaaaapkdkvsp
    hkshligeiactschkgheksvaycdachsfgfdmpfggkwerkfvpvdadkaaqdkaia
    agvkettdvviigsggaglaaavsardagakvillekepipggntklaaggmnaaetkpq
    aklgiedkkqimiddtmkggrnindpelvkvlannssdsidwltsmgadmtdvgrmggas
    vnrshrptggagvgahvaqvlwdnavkrgtdirlnsrvvriledasgkvtgvlvkgeytg
    yyvikadavviaaggfaknnervskydpklkgfkatnhpgatgdgldvalqagaatrdle
    yiqahptyspaggvmiteavrgngaivvnregnrfmneittrdkasaailqqkgesaylv
    fddsirkslkaiegyvhlnivkegktieelakqidvpaaelaktvtayngfvksgkdaqf
    erpdlprelvvapfyaleiapavhhtmgglvidtkaevksektgkpitglyaagevtggv
    hganrlggnaisdivtygriagasaakfakdn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1d4cD (D:)
    apevladfhgemggcdschvsdkggvtndnlthengqcvschgdlkelaaaapkdkvsph
    kshligeiactschkgheksvaycdachsfgfdmpfggkwerkfvpvdadkaaqdkaiaa
    gvkettdvviigsggaglaaavsardagakvillekepipggntklaaggmnaaetkpqa
    klgiedkkqimiddtmkggrnindpelvkvlannssdsidwltsmgadmtdvgrmggasv
    nrshrptggagvgahvaqvlwdnavkrgtdirlnsrvvriledasgkvtgvlvkgeytgy
    yvikadavviaaggfaknnervskydpklkgfkatnhpgatgdgldvalqagaatrdley
    iqahptyspaggvmiteavrgngaivvnregnrfmneittrdkasaailqqkgesaylvf
    ddsirkslkaiegyvhlnivkegktieelakqidvpaaelaktvtayngfvksgkdaqfe
    rpdlprelvvapfyaleiapavhhtmgglvidtkaevksektgkpitglyaagevtggvh
    ganrlggnaisdivtygriagasaakfakd