Lineage for d1eysc_ (1eys C:)

  1. Root: SCOP 1.55
  2. 2Class a: All alpha proteins [46456] (138 folds)
  3. 6906Fold a.138: Multiheme cytochromes [48694] (1 superfamily)
  4. 6907Superfamily a.138.1: Multiheme cytochromes [48695] (3 families) (S)
  5. 6941Family a.138.1.2: Photosynthetic reaction centre (cytochrome subunit) [48707] (1 protein)
  6. 6942Protein Photosynthetic reaction centre (cytochrome subunit) [48708] (2 species)
  7. 6952Species Thermochromatium tepidum [TaxId:1050] [48710] (1 PDB entry)
  8. 6953Domain d1eysc_: 1eys C: [19678]
    Other proteins in same PDB: d1eysh1, d1eysh2, d1eysl1, d1eysm1

Details for d1eysc_

PDB Entry: 1eys (more details), 2.2 Å

PDB Description: crystal structure of photosynthetic reaction center from a thermophilic bacterium, thermochromatium tepidum

SCOP Domain Sequences for d1eysc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1eysc_ a.138.1.2 (C:) Photosynthetic reaction centre (cytochrome subunit) {Thermochromatium tepidum}
cegpppgteqigyrgvgmenyyvkrqralsiqanqpveslpaadstgpkasevyqsvqvl
kdlsvgeftrtmvavttwvspkegcnychvpgnwasddiytkvvsrrmfelvraansdwk
ahvaetgvtcytchrgnpvpkyawvtdpgpkypsglkptgqnygsktvayaslpfdpltp
fldqaneiritgnaalagsnpaslkqaewtfglmmnisdslgvgctschntrafndwtqs
tpkrttawyairhvrdinqnyiwplndvlpasrkgpygdplrvscmtchqavnkplygaq
makdypglyk

SCOP Domain Coordinates for d1eysc_:

Click to download the PDB-style file with coordinates for d1eysc_.
(The format of our PDB-style files is described here.)

Timeline for d1eysc_: