Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.113: Nudix [55810] (1 superfamily) beta(2)-alpha-beta(3)-alpha; 3 layers: alpha/beta/alpha; mixed sheet contains beta-grasp motif |
Superfamily d.113.1: Nudix [55811] (8 families) |
Family d.113.1.1: MutT-like [55812] (17 proteins) |
Protein automated matches [190465] (3 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [189707] (5 PDB entries) |
Domain d3mcfb_: 3mcf B: [196459] automated match to d2duka_ complexed with flc, gol |
PDB Entry: 3mcf (more details), 2 Å
SCOPe Domain Sequences for d3mcfb_:
Sequence, based on SEQRES records: (download)
>d3mcfb_ d.113.1.1 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]} mkkraaclcfrseredevllvsssrypdrwivpgggmepeeepggaavrevyeeagvkgk lgrllgvfeqnqdpehrtyvyvltvtelledwedsvsigrkrewfkvedaikvlqchkpv haeyleklk
>d3mcfb_ d.113.1.1 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]} mkkraaclcfrseredevllvsssrypdrwivpgggmepeeepggaavrevyeeagvkgk lgrllgvfehrtyvyvltvtelledwedsvsigrkrewfkvedaikvlqchkpvhaeyle klk
Timeline for d3mcfb_: