Lineage for d3mcfb_ (3mcf B:)

  1. Root: SCOPe 2.02
  2. 1190016Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1216197Fold d.113: Nudix [55810] (1 superfamily)
    beta(2)-alpha-beta(3)-alpha; 3 layers: alpha/beta/alpha; mixed sheet
    contains beta-grasp motif
  4. 1216198Superfamily d.113.1: Nudix [55811] (8 families) (S)
  5. 1216199Family d.113.1.1: MutT-like [55812] (17 proteins)
  6. 1216335Protein automated matches [190465] (3 species)
    not a true protein
  7. 1216348Species Human (Homo sapiens) [TaxId:9606] [189707] (5 PDB entries)
  8. 1216353Domain d3mcfb_: 3mcf B: [196459]
    automated match to d2duka_
    complexed with flc, gol

Details for d3mcfb_

PDB Entry: 3mcf (more details), 2 Å

PDB Description: crystal structure of human diphosphoinositol polyphosphate phosphohydrolase 3-alpha
PDB Compounds: (B:) Diphosphoinositol polyphosphate phosphohydrolase 3-alpha

SCOPe Domain Sequences for d3mcfb_:

Sequence, based on SEQRES records: (download)

>d3mcfb_ d.113.1.1 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mkkraaclcfrseredevllvsssrypdrwivpgggmepeeepggaavrevyeeagvkgk
lgrllgvfeqnqdpehrtyvyvltvtelledwedsvsigrkrewfkvedaikvlqchkpv
haeyleklk

Sequence, based on observed residues (ATOM records): (download)

>d3mcfb_ d.113.1.1 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mkkraaclcfrseredevllvsssrypdrwivpgggmepeeepggaavrevyeeagvkgk
lgrllgvfehrtyvyvltvtelledwedsvsigrkrewfkvedaikvlqchkpvhaeyle
klk

SCOPe Domain Coordinates for d3mcfb_:

Click to download the PDB-style file with coordinates for d3mcfb_.
(The format of our PDB-style files is described here.)

Timeline for d3mcfb_: