Lineage for d2duka_ (2duk A:)
- Root: SCOPe 2.02
Class d: Alpha and beta proteins (a+b) [53931] (376 folds) 
Fold d.113: Nudix [55810] (1 superfamily)
beta(2)-alpha-beta(3)-alpha; 3 layers: alpha/beta/alpha; mixed sheet
contains beta-grasp motifSuperfamily d.113.1: Nudix [55811] (8 families) 
Family d.113.1.1: MutT-like [55812] (17 proteins) 
Protein automated matches [190465] (3 species)
not a true protein
Species Mouse (Mus musculus) [TaxId:10090] [187640] (1 PDB entry) 
Domain d2duka_: 2duk A: [163705]
automated match to d2fvva1
Details for d2duka_
PDB Entry: 2duk (more details), 2.62 Å
PDB Description: Crystal structure of MS0616
PDB Compounds: (A:) ms0616SCOPe Domain Sequences for d2duka_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2duka_ d.113.1.1 (A:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
trtydregfkkraaclcfrseqedevllvsssrypdqwivpgggmepeeepggaavrevy
eeagvkgklgrllgifenqdrkhrtyvyvltvteiledwedsvnigrkrewfkvedaikv
lqchkpvhaeyleklklg
SCOPe Domain Coordinates for d2duka_:
Click to download the PDB-style file with coordinates for d2duka_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2duka_:
- d2duka_ first appeared in SCOPe 2.01
- d2duka_ appears in SCOPe 2.03
- d2duka_ appears in the current release, SCOPe 2.08
View in 3D
