Lineage for d3mcfb1 (3mcf B:17-144)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2971307Fold d.113: Nudix [55810] (1 superfamily)
    beta(2)-alpha-beta(3)-alpha; 3 layers: alpha/beta/alpha; mixed sheet
    contains beta-grasp motif
  4. 2971308Superfamily d.113.1: Nudix [55811] (8 families) (S)
  5. 2971309Family d.113.1.1: MutT-like [55812] (17 proteins)
  6. 2971606Protein automated matches [190465] (6 species)
    not a true protein
  7. 2971623Species Human (Homo sapiens) [TaxId:9606] [189707] (13 PDB entries)
  8. 2971632Domain d3mcfb1: 3mcf B:17-144 [196459]
    Other proteins in same PDB: d3mcfa2, d3mcfa3, d3mcfb2
    automated match to d2duka_
    complexed with flc, gol

Details for d3mcfb1

PDB Entry: 3mcf (more details), 2 Å

PDB Description: crystal structure of human diphosphoinositol polyphosphate phosphohydrolase 3-alpha
PDB Compounds: (B:) Diphosphoinositol polyphosphate phosphohydrolase 3-alpha

SCOPe Domain Sequences for d3mcfb1:

Sequence, based on SEQRES records: (download)

>d3mcfb1 d.113.1.1 (B:17-144) automated matches {Human (Homo sapiens) [TaxId: 9606]}
kkraaclcfrseredevllvsssrypdrwivpgggmepeeepggaavrevyeeagvkgkl
grllgvfeqnqdpehrtyvyvltvtelledwedsvsigrkrewfkvedaikvlqchkpvh
aeyleklk

Sequence, based on observed residues (ATOM records): (download)

>d3mcfb1 d.113.1.1 (B:17-144) automated matches {Human (Homo sapiens) [TaxId: 9606]}
kkraaclcfrseredevllvsssrypdrwivpgggmepeeepggaavrevyeeagvkgkl
grllgvfehrtyvyvltvtelledwedsvsigrkrewfkvedaikvlqchkpvhaeylek
lk

SCOPe Domain Coordinates for d3mcfb1:

Click to download the PDB-style file with coordinates for d3mcfb1.
(The format of our PDB-style files is described here.)

Timeline for d3mcfb1: