![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.85: beta-clip [51268] (7 superfamilies) double-stranded ribbon sharply bent in two places; the ribbon ends form incomplete barrel; jelly-roll |
![]() | Superfamily b.85.4: dUTPase-like [51283] (2 families) ![]() forms tight trimer through an additional beta-sheet in each subunit subunit beta-sheets are orthogonally packed around the three-fold axis |
![]() | Family b.85.4.1: dUTPase-like [51284] (5 proteins) |
![]() | Protein automated matches [190798] (9 species) not a true protein |
![]() | Species Plasmodium falciparum [TaxId:36329] [188061] (4 PDB entries) |
![]() | Domain d2y8cb_: 2y8c B: [195844] automated match to d1vyqa1 complexed with duq, so4 |
PDB Entry: 2y8c (more details), 2.1 Å
SCOPe Domain Sequences for d2y8cb_:
Sequence, based on SEQRES records: (download)
>d2y8cb_ b.85.4.1 (B:) automated matches {Plasmodium falciparum [TaxId: 36329]} mhlkivclsdevremyknhkthhegdsgldlfivkdevlkpksttfvklgikaialqyks nyyykceksenkkkdddksnivntsfllfprssisktplrlansiglidagyrgeiiaal dntsdqeyhikkndklvqlvsftgeplsfelvee
>d2y8cb_ b.85.4.1 (B:) automated matches {Plasmodium falciparum [TaxId: 36329]} mhlkivclsdevremyknhdsgldlfivkdevlkpksttfvklgikaialqntsfllfpr ssisktplrlansiglidagyrgeiiaaldntsdqeyhikkndklvqlvsftgeplsfel vee
Timeline for d2y8cb_: