Lineage for d1vyqa1 (1vyq A:1-159)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2817864Fold b.85: beta-clip [51268] (7 superfamilies)
    double-stranded ribbon sharply bent in two places; the ribbon ends form incomplete barrel; jelly-roll
  4. 2818071Superfamily b.85.4: dUTPase-like [51283] (2 families) (S)
    forms tight trimer through an additional beta-sheet in each subunit
    subunit beta-sheets are orthogonally packed around the three-fold axis
  5. 2818072Family b.85.4.1: dUTPase-like [51284] (5 proteins)
  6. 2818142Protein Deoxyuridine 5'-triphosphate nucleotidohydrolase (dUTPase) [51285] (7 species)
  7. 2818183Species Malaria parasite (Plasmodium falciparum) [TaxId:5833] [141654] (1 PDB entry)
    Uniprot Q8II92 1-159
  8. 2818184Domain d1vyqa1: 1vyq A:1-159 [120548]
    Other proteins in same PDB: d1vyqb_, d1vyqc_
    complexed with dux

Details for d1vyqa1

PDB Entry: 1vyq (more details), 2.4 Å

PDB Description: novel inhibitors of plasmodium falciparum dutpase provide a platform for anti-malarial drug design
PDB Compounds: (A:) deoxyuridine 5'-triphosphate nucleotidohydrolase

SCOPe Domain Sequences for d1vyqa1:

Sequence, based on SEQRES records: (download)

>d1vyqa1 b.85.4.1 (A:1-159) Deoxyuridine 5'-triphosphate nucleotidohydrolase (dUTPase) {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]}
mhlkivclsdevremyknhkthhegdsgldlfivkdevlkpksttfvklgikaialqyks
nyyykceksenkkkdddksnivntsfllfprssisktplrlansiglidagyrgeiiaal
dntsdqeyhikkndklvqlvsftgeplsfelveeldets

Sequence, based on observed residues (ATOM records): (download)

>d1vyqa1 b.85.4.1 (A:1-159) Deoxyuridine 5'-triphosphate nucleotidohydrolase (dUTPase) {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]}
mhlkivclsdevremyknhkthhedsgldlfivkdevlkpksttfvklgikaialqyksn
yynivntsfllfprssisktplrlansiglidagyrgeiiaaldntsdqeyhikkndklv
qlvsftgeplsfelveeldets

SCOPe Domain Coordinates for d1vyqa1:

Click to download the PDB-style file with coordinates for d1vyqa1.
(The format of our PDB-style files is described here.)

Timeline for d1vyqa1: