Lineage for d1vyqb_ (1vyq B:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2817864Fold b.85: beta-clip [51268] (7 superfamilies)
    double-stranded ribbon sharply bent in two places; the ribbon ends form incomplete barrel; jelly-roll
  4. 2818071Superfamily b.85.4: dUTPase-like [51283] (2 families) (S)
    forms tight trimer through an additional beta-sheet in each subunit
    subunit beta-sheets are orthogonally packed around the three-fold axis
  5. 2818072Family b.85.4.1: dUTPase-like [51284] (5 proteins)
  6. 2818226Protein automated matches [190798] (9 species)
    not a true protein
  7. 2818258Species Plasmodium falciparum [TaxId:36329] [188061] (4 PDB entries)
  8. 2818268Domain d1vyqb_: 1vyq B: [120549]
    Other proteins in same PDB: d1vyqa1
    automated match to d1vyqa1
    complexed with dux

Details for d1vyqb_

PDB Entry: 1vyq (more details), 2.4 Å

PDB Description: novel inhibitors of plasmodium falciparum dutpase provide a platform for anti-malarial drug design
PDB Compounds: (B:) deoxyuridine 5'-triphosphate nucleotidohydrolase

SCOPe Domain Sequences for d1vyqb_:

Sequence, based on SEQRES records: (download)

>d1vyqb_ b.85.4.1 (B:) automated matches {Plasmodium falciparum [TaxId: 36329]}
mhlkivclsdevremyknhkthhegdsgldlfivkdevlkpksttfvklgikaialqyks
nyyykceksenkkkdddksnivntsfllfprssisktplrlansiglidagyrgeiiaal
dntsdqeyhikkndklvqlvsftgeplsfelvee

Sequence, based on observed residues (ATOM records): (download)

>d1vyqb_ b.85.4.1 (B:) automated matches {Plasmodium falciparum [TaxId: 36329]}
mhlkivclsdevremyknhkthhegdsgldlfivkdevlkpksttfvklgikaialqyks
nyyyknivntsfllfprssisktplrlansiglidagyrgeiiaaldntsdqeyhikknd
klvqlvsftgeplsfelvee

SCOPe Domain Coordinates for d1vyqb_:

Click to download the PDB-style file with coordinates for d1vyqb_.
(The format of our PDB-style files is described here.)

Timeline for d1vyqb_: