Class b: All beta proteins [48724] (180 folds) |
Fold b.85: beta-clip [51268] (7 superfamilies) double-stranded ribbon sharply bent in two places; the ribbon ends form incomplete barrel; jelly-roll |
Superfamily b.85.4: dUTPase-like [51283] (2 families) forms tight trimer through an additional beta-sheet in each subunit subunit beta-sheets are orthogonally packed around the three-fold axis |
Family b.85.4.1: dUTPase-like [51284] (5 proteins) |
Protein automated matches [190798] (9 species) not a true protein |
Species Plasmodium falciparum [TaxId:36329] [188061] (4 PDB entries) |
Domain d1vyqb_: 1vyq B: [120549] Other proteins in same PDB: d1vyqa1 automated match to d1vyqa1 complexed with dux |
PDB Entry: 1vyq (more details), 2.4 Å
SCOPe Domain Sequences for d1vyqb_:
Sequence, based on SEQRES records: (download)
>d1vyqb_ b.85.4.1 (B:) automated matches {Plasmodium falciparum [TaxId: 36329]} mhlkivclsdevremyknhkthhegdsgldlfivkdevlkpksttfvklgikaialqyks nyyykceksenkkkdddksnivntsfllfprssisktplrlansiglidagyrgeiiaal dntsdqeyhikkndklvqlvsftgeplsfelvee
>d1vyqb_ b.85.4.1 (B:) automated matches {Plasmodium falciparum [TaxId: 36329]} mhlkivclsdevremyknhkthhegdsgldlfivkdevlkpksttfvklgikaialqyks nyyyknivntsfllfprssisktplrlansiglidagyrgeiiaaldntsdqeyhikknd klvqlvsftgeplsfelvee
Timeline for d1vyqb_: