PDB entry 1vyq

View 1vyq on RCSB PDB site
Description: novel inhibitors of plasmodium falciparum dutpase provide a platform for anti-malarial drug design
Class: hydrolase
Keywords: drug design, plasmodium falciparum, dutpase, deoxyuridine nucleotidohydrolase, malaria, hydrolase
Deposited on 2004-05-05, released 2005-05-26
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.196
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: deoxyuridine 5'-triphosphate nucleotidohydrolase
    Species: PLASMODIUM FALCIPARUM [TaxId:36329]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1vyqa1
  • Chain 'B':
    Compound: deoxyuridine 5'-triphosphate nucleotidohydrolase
    Species: PLASMODIUM FALCIPARUM [TaxId:36329]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1vyqb_
  • Chain 'C':
    Compound: deoxyuridine 5'-triphosphate nucleotidohydrolase
    Species: PLASMODIUM FALCIPARUM [TaxId:36329]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1vyqc_
  • Heterogens: DUX, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1vyqA (A:)
    mhlkivclsdevremyknhkthhegdsgldlfivkdevlkpksttfvklgikaialqyks
    nyyykceksenkkkdddksnivntsfllfprssisktplrlansiglidagyrgeiiaal
    dntsdqeyhikkndklvqlvsftgeplsfelveeldetsrgeggfgstsnnky
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vyqA (A:)
    mhlkivclsdevremyknhkthhedsgldlfivkdevlkpksttfvklgikaialqyksn
    yynivntsfllfprssisktplrlansiglidagyrgeiiaaldntsdqeyhikkndklv
    qlvsftgeplsfelveeldets
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1vyqB (B:)
    mhlkivclsdevremyknhkthhegdsgldlfivkdevlkpksttfvklgikaialqyks
    nyyykceksenkkkdddksnivntsfllfprssisktplrlansiglidagyrgeiiaal
    dntsdqeyhikkndklvqlvsftgeplsfelveeldetsrgeggfgstsnnky
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vyqB (B:)
    mhlkivclsdevremyknhkthhegdsgldlfivkdevlkpksttfvklgikaialqyks
    nyyyknivntsfllfprssisktplrlansiglidagyrgeiiaaldntsdqeyhikknd
    klvqlvsftgeplsfelvee
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1vyqC (C:)
    mhlkivclsdevremyknhkthhegdsgldlfivkdevlkpksttfvklgikaialqyks
    nyyykceksenkkkdddksnivntsfllfprssisktplrlansiglidagyrgeiiaal
    dntsdqeyhikkndklvqlvsftgeplsfelveeldetsrgeggfgstsnnky
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vyqC (C:)
    mhlkivclsdevremyknhkthhdsgldlfivkdevlkpksttfvklgikaialqyksny
    yykksnivntsfllfprssisktplrlansiglidagyrgeiiaaldntsdqeyhikknd
    klvqlvsftgeplsfelveel