Lineage for d2y8cb_ (2y8c B:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2427208Fold b.85: beta-clip [51268] (7 superfamilies)
    double-stranded ribbon sharply bent in two places; the ribbon ends form incomplete barrel; jelly-roll
  4. 2427417Superfamily b.85.4: dUTPase-like [51283] (2 families) (S)
    forms tight trimer through an additional beta-sheet in each subunit
    subunit beta-sheets are orthogonally packed around the three-fold axis
  5. 2427418Family b.85.4.1: dUTPase-like [51284] (5 proteins)
  6. 2427572Protein automated matches [190798] (9 species)
    not a true protein
  7. 2427604Species Plasmodium falciparum [TaxId:36329] [188061] (4 PDB entries)
  8. 2427609Domain d2y8cb_: 2y8c B: [195844]
    automated match to d1vyqa1
    complexed with duq, so4

Details for d2y8cb_

PDB Entry: 2y8c (more details), 2.1 Å

PDB Description: Plasmodium falciparum dUTPase in complex with a trityl ligand
PDB Compounds: (B:) deoxyuridine 5'-triphosphate nucleotidohydrolase

SCOPe Domain Sequences for d2y8cb_:

Sequence, based on SEQRES records: (download)

>d2y8cb_ b.85.4.1 (B:) automated matches {Plasmodium falciparum [TaxId: 36329]}
mhlkivclsdevremyknhkthhegdsgldlfivkdevlkpksttfvklgikaialqyks
nyyykceksenkkkdddksnivntsfllfprssisktplrlansiglidagyrgeiiaal
dntsdqeyhikkndklvqlvsftgeplsfelvee

Sequence, based on observed residues (ATOM records): (download)

>d2y8cb_ b.85.4.1 (B:) automated matches {Plasmodium falciparum [TaxId: 36329]}
mhlkivclsdevremyknhdsgldlfivkdevlkpksttfvklgikaialqntsfllfpr
ssisktplrlansiglidagyrgeiiaaldntsdqeyhikkndklvqlvsftgeplsfel
vee

SCOPe Domain Coordinates for d2y8cb_:

Click to download the PDB-style file with coordinates for d2y8cb_.
(The format of our PDB-style files is described here.)

Timeline for d2y8cb_: