SCOPe 2.07: Domain d2y8cc_: 2y8c C:

Lineage for d2y8cc_ (2y8c C:)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.85: beta-clip [51268] (7 superfamilies)
   double-stranded ribbon sharply bent in two places; the ribbon ends form incomplete barrel; jelly-roll

4. Superfamily b.85.4: dUTPase-like [51283] (2 families)
   forms tight trimer through an additional beta-sheet in each subunit
   subunit beta-sheets are orthogonally packed around the three-fold axis

5. Family b.85.4.1: dUTPase-like [51284] (5 proteins)

6. Protein automated matches [190798] (9 species)
   not a true protein

7. Species Plasmodium falciparum [TaxId:36329] [188061] (4 PDB entries)

8. Domain d2y8cc_: 2y8c C: [198688]
   automated match to d2y8ca_
   complexed with duq, so4

Details for d2y8cc_

PDB Entry: 2y8c, 2.1 Å

PDB Description: Plasmodium falciparum dUTPase in complex with a trityl ligand

PDB Compounds: (C:) deoxyuridine 5'-triphosphate nucleotidohydrolase

SCOPe Domain Sequences for d2y8cc_:

Sequence, based on SEQRES records:

>d2y8cc_ b.85.4.1 (C:) automated matches {Plasmodium falciparum [TaxId: 36329]}
mhlkivclsdevremyknhkthhegdsgldlfivkdevlkpksttfvklgikaialqyks
nyyykceksenkkkdddksnivntsfllfprssisktplrlansiglidagyrgeiiaal
dntsdqeyhikkndklvqlvsftgeplsfelveeldetsrgeggfgs

Sequence, based on observed residues (ATOM records):

>d2y8cc_ b.85.4.1 (C:) automated matches {Plasmodium falciparum [TaxId: 36329]}
mhlkivclsdevremyknhsgldlfivkdevlkpksttfvklgikaialqvntsfllfpr
ssisktplrlansiglidagyrgeiiaaldntsdqeyhikkndklvqlvsftgeplsfel
veeldetsrgeggfgs

Timeline for d2y8cc_:

• d2y8cc_ first appeared in SCOPe 2.03
  
• d2y8cc_ appears in SCOPe 2.06
  
• d2y8cc_ appears in the current release, SCOPe 2.08