SCOPe 2.02: Domain d3sjqc_: 3sjq C:

Lineage for d3sjqc_ (3sjq C:)

1. Root: SCOPe 2.02

2. Class f: Membrane and cell surface proteins and peptides [56835] (57 folds)

3. Fold f.15: Small-conductance potassium channel [81328] (1 superfamily)
   oligomeric transmembrane alpha-helical protein

4. Superfamily f.15.1: Small-conductance potassium channel [81327] (1 family)

5. Family f.15.1.1: Small-conductance potassium channel [81326] (3 proteins)

6. Protein automated matches [195258] (1 species)
   not a true protein

7. Species Rattus norvegicus [TaxId:10116] [195260] (1 PDB entry)

8. Domain d3sjqc_: 3sjq C: [195261]
   Other proteins in same PDB: d3sjqd_
   automated match to d1g4yb_
   complexed with ca, gol, phu, so4

Details for d3sjqc_

PDB Entry: 3sjq, 1.9 Å

PDB Description: Crystal structure of a small conductance potassium channel splice variant complexed with calcium-calmodulin

PDB Compounds: (C:) Small conductance calcium-activated potassium channel protein 2

SCOPe Domain Sequences for d3sjqc_:

Sequence; same for both SEQRES and ATOM records:

>d3sjqc_ f.15.1.1 (C:) automated matches {Rattus norvegicus [TaxId: 10116]}
tqltkrvknaaanvlretwliykntklvkkidhakvrkhqrkflqaihqarklrsvkmeq
rklndqantlvdlaktqleh

Timeline for d3sjqc_:

• d3sjqc_ is new in SCOPe 2.02-stable
  
• d3sjqc_ appears in SCOPe 2.03
  
• d3sjqc_ appears in the current release, SCOPe 2.08, called d3sjqc1